Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G109244-GRMZM2G054591
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100277720
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MATTAFLPPAKLPLQGRRFASPKTAGRISVRVPPARAQQEQQVKEEEAEVASVPPPQDAE
KQARKGDAQSLPRQPLAESKNMSREYGGQWLSSTTRHVRIYAAYIDPVTNAFDQTQMDKL
TLMLDPQDEFAWTDEACQMVFNEFQDLVDHYEGAELSEYTLRLIGSDLEHYIRKLLYDGV
IKYNMRSRVLNFSMGKPRIKFNSNQIPEKI*

MATTAFLSPPKLSLPGRRFASARTAGRVRVPPARAQEQQQQVVVVVEEEEAEVASVPPPP
QSAEEQAQARKGDAAAAGGEQEHEPRVRRAVAEQHDAARAHLRGVHRPGDERVRPDADGQ
ADAHAGPAAQDEFP*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):62GC content 2 (%):70GC content divergence:0.061
Length 1 (bp):633Length 2 (bp):405Length divergence:-0.22
MFE 1 (kcal):-253.6MFE 2 (kcal):-183.3MFE divergence-0.161