Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G109332-GRMZM2G142109
Species:maize
Duplication type:TD
Function (paralog1):Cytochrome c oxidase subunit 2 (EC 1.9.3.1)(Cytochrome c oxidase polypeptide II)
Function (paralog2):Cytochrome oxidase subunit II Fragment

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.80949605750291
Log2 mRNA fold difference:-0.6957791814469
Log2 TE fold difference:-0.10830576768514
Sequences
Protein sequence

MELSSTMIFLLTDRKMLLSSSKPIMIATRGMPGIPLNRESESVEDVHRVLRALPLFREME
GILRERNLNLPSVQEISAFRVNLFSGIRRESAIADYDAFWRSLLEEIHTPQGRSCFGQRI
QDLHARMSAEGNWDYLIAQQGRGYFGNLPNLNSPLDQYQFGIHPILDLNIGEYYVSFTNL
SLSMLLTLGLVLLLVLPMILRSLECRFLTIALCDAAEPWQLGSQDAATPMMQGIIDLHHD
IFFFLILILVFVSRMLVRALWHFNEQTNPIPQRIVHGTTIEIIRTIFPSVIPLFIAIPSF
ALLYSMDGVLVDPAITIKAIGHQWYRTYEYSDYNSSDEQSLTFDSYTIPEDDPELGQSRL
LEVDNRVVVPAKTHLRMIVTPADVPHSWAVPSSGVKCDAVPGRSNLTSISVQREGVYYGQ
CSEICGTNHAFTPIVVEAVTLKDYADWVSNQLILQTN*

MDQSSLLSLLGAELKKMELSSTMIFLLTDRKMLLSSSKPIMIATRGMPGIPLNRESESVE
DVHRVLRALPLFREMEGILRERNLNLPSVQEISAFRVNLFSGIRRESAIADYDAFWRSLL
EEIHTPQGRSCFGQRIQDLHARMSAEGNWDYLIAQQGRGYFGNLPNLNSPLDQYQFGIHP
ILDLNIGEYYVSFTNLSLSMLLTLGLVLLLVLPMILRSLECRFLTIALCDAAEPWQLGSQ
DAATMMQGIIDLHHDIFFFLILILVFVSRMLVRALWHFNEQTNPIPQRIVHGTTIEIIRT
IFPSVIPLFIAIPSFALLYSMDGVLVDPAITIKAIGHQWRASTQPYEYSDYNSSDEQSLT
FDSYTIPEDDPELGQSRLLEVDNRVVVPAKTHLRMIVTPADVPHSWAVPSSGVKCDAVPG
RSNLTSISVQREGVYYG*

Other information
Ka divergence:-1KaKs divergence:-0.999737
GC content 1 (%):43GC content 2 (%):43GC content divergence:0
Length 1 (bp):1374Length 2 (bp):1314Length divergence:-0.022
MFE 1 (kcal):-398.67MFE 2 (kcal):-388.75MFE divergence-0.013