Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G109348-GRMZM2G129675
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100273282
Function (paralog2):hypothetical protein LOC100278308

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.64441341108095
Log2 mRNA fold difference:-1.2156146814814
Log2 TE fold difference:1.7930310484738
Sequences
Protein sequence

MASLSDSAGAGSGGRAGAELMVPQFLLKVLHAILAARSPRPHAPPPPPPAASAFRRRDRW
FHLPLHLPPAAEHLPEPSPAEPLVVDVYLAPSGGGPEEVLERWTVACEPWPSPAAAGEGL
AVNRAYKRCITLLRSLYAMLRFLPAYRAFRALCASGQVYNYEMGHRVGSFSTPFSRAEEA
TMRTERLAPVETQLGRLVVSVQYLPSLAAFSFNATSLASAAIITDYVGSPAAEPMRAFPA
SLTEAAGSPSPQPSRRPNSWASPAPWPHTMRQPAKFSPPPAHYASPTPSPPMFGYLHSRF
SGETAPMSIPQAGGGRGPMHQHHQNLSEPSRAFMFPPPSPKYLRGEAGRQESPTETNRSF
KRADGIRMGDLYANLPSGYKIKDSRDESGRSSGVFSSSGSPQLGFSRSSSRLSMQDDTDD
ADFPFAVDDVDPDSRPGSSGGKDTGDPVGSSFHKSQDAAVGYLVHLLKSARPLRDFSYSS
HTSMGESIEAGSTSSFMSRRTSDALEEFESFKEIRENLLARSRSWLQDSLDKS*

MASLSDSAGAGGGRAGAELMVPQFLLKALHAILAVRSPRPHAPPAPAASASAFRRRDRWF
HLPIHAPPPPPAAEHLPDPSPGEPLVVDVYLAPSGGGPEEVLERWTVACEPWPSPAAAAA
VGEGLAVNRAYKRCITLLRSLYAALRFLPAYRAFRRLCASGQVYNYCMGHRVGSFAAPFS
RAEEAAMRTKRLAPVETQLGRLVVSVQYLPSLAAFNFEVTSLASAAIITDYVGSPAAEPM
RAFPPSLTEATGSPFPQPSRRPNSWASPAPWPHTLGQPAKFSPPPAHYASPTPSPPTFGY
LHSRFSGETAPMTIPQAGGGRGTVHHRNMSEPSRAFMFPPPSPKNVRGEAGMQESPTEIN
RSFKRADGIRMGDLYSNLPSGSKIKDTKDESGRFSGVFSSSGSPRHGFSRSSSRLSMQDD
TDDADFPFAVDDVYPDSRPGSSSGKDTGDQAGSSSHKSQDAAVGYLVHLLKSARPLRDST
YSSHTSRGESTEAGSTSSFLSRRTSDALEEFESFKETRENLLARSRSRLQDSLDKP*

Other information
Ka divergence:-0.250156KaKs divergence:-0.105412
GC content 1 (%):62GC content 2 (%):63GC content divergence:0.008
Length 1 (bp):1602Length 2 (bp):1611Length divergence:0.003
MFE 1 (kcal):-723.98MFE 2 (kcal):-740.91MFE divergence0.012