Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G109448-GRMZM5G873455
Species:maize
Duplication type:WGD
Function (paralog1):Histone H2A
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MDASGAGSKAKKGAAGRKAGGPRKKSVSRSVKAGLQFPVGRIGRYLKKGRYAQRVGTGAP
VYLAAVLEYLAAEVLELAGNAAKDNKKTRIVPRHVLLAIRNDVELGKLLAGVTIAHGGVL
PNINPVLLPKKVAEKASSGGSKESKSPKKAAKSPKKAAKSPKKA*

MLQHTAQMKTLLSKPSWGTWRPSWGTWAPCCRRWPPSPPPSWAGARSGCWGGRRVPCQLQ
NLGGEVLQDGGEVDGGASAHALRVPALLEVAPDPADGELQPGLDGPRHRLLPGAACLAPG
RP

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):67GC content 2 (%):68GC content divergence:0.007
Length 1 (bp):495Length 2 (bp):366Length divergence:-0.15
MFE 1 (kcal):-225.6MFE 2 (kcal):-162.69MFE divergence-0.162