Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G109560-GRMZM2G017961
Species:maize
Duplication type:WGD
Function (paralog1):Lon protease homolog 2, peroxisomal (EC 3.4.21.-)
Function (paralog2):hypothetical protein LOC100384172

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MSDSPVELPSRLAVLPFRNKVLLPGAIVRIRCTNPSSVKLVEQELWQKEEKGLIGVLPVR
DSEATAVGSLLSPGVGSDSGEGGSKVGGSAVESSKQDTKNGKEPIHWHSKGVAARALHLS
RGVEKPSGRVTYIVVLEGLCRFSVQELSARGPYHVARVSRLDMTKTELEQAEQDPDLIAL
SRQFKATAMELISVLEQKQKTVGRTKVLLDTVPVYRLADIFVASFEISFEEQLSMLDSVH
LKVRLSKATELVDRHLQSILVAEKITQKVEGQLSKSQKEFLLRQQMRAIKEELGDNDDDE
DDVAALERKMQNAGMPANIWKHAQREMRRLRKMQPQQPGYSSSRAYLELLADLPWQKVSE
ERELDLRVAKESLDQDHYGLTKVKQRIIEYLAVRKLKPDARGPVLCFVGPPGVGKTSLAS
SIAKALNRKFIRISLGGVKDEADIRGHRRTYIGSMPGRLIDGLKRVSVSNPVMLLDEIDK
TGSDVRGDPASALLEVLDPEQNKAFNDHYLNVPFDLSKVIFVATANRMQPIPPPLLDRME
IIELPGYTPEEKLKIAMKHLIPRVLEQHGLSTTNLQIPEAMVKLVIERYTREAGVRNLER
NLAALARAAAVKVAEQVKTLRLGKEIQPITTTLLDSRLADGGEVEMEVIPMEHDISNTYE
NPSPMIVDEAMLEKVLGPPRFDDREAADRVASPGVSVGLVWTSVGGEVQFVEATAMVGKG
DLHLTGQLGDVIKESAQLALTWVRARAADLNLSPTSDINLLESRDIHIHFPAGAVPKDGP
SAGVTLVTALVSLFSNRKVRADTAMTGEMTLRGLVLPVGGVKDKVLAAHRYGIKRVILPE
RNLKDLSEVPLPILSDMEILLVKRIEEVLDHAFEGRCPLRSRSKL*

MPGRLIDGLKRVSVSNPVMLLDEIDKTGSDVRGDPASALLEVLDPEQNKAFNDHYLNVPF
DLSKVIFVATANKMQPIPPPLLDRMEVIELPGYTPEEKLKIAMKHLIPRVLEQHGLSTAN
LQIPEAMVKLIIERYTREAGVRNLERNLAALARAAAVKVAEQVKTLRLGKEIQPITTTLL
DSRLADGGEVEMEVIPMGHDMSNTYENPSPMTVDEAMLEKVLGPPRFDDTEAADRVASPG
VSVGLVWTSVGGEVQFVEATAMVGKGDLHLTGQLGDVIKESAQLALTWVRARAADLNLSP
ASDINLLESRDIHIHFPAGAVPKDGPSAGVTLVTALVSLFSNRKVRADTAMTGEMTLRGI
VLPVGGVKDKVLAAHRYGIKRVILRERNMKDLSEVPSPILSGMEILLVKHIEDVLDHAFE
GGCPLKSRSKL*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):47GC content 2 (%):45GC content divergence:-0.022
Length 1 (bp):2658Length 2 (bp):1296Length divergence:-0.344
MFE 1 (kcal):-914.11MFE 2 (kcal):-432.72MFE divergence-0.357