Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G109869-GRMZM2G173429
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100273177 (LOC100273177), mRNA

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.0072591662448558
Log2 mRNA fold difference:-0.11546132234586
Log2 TE fold difference:0.072681898175906
Sequences
Protein sequence

MEPGAPWRDPRQGYSYGVGSAMQLQLQLQQRADAAAGGGVLKRSLGELERWQHHQQQQVA
AQQALYLRAVRQRTAAAVDIAALLGGTPAQPLVLPGSSFGGGLASPSSTLSSSLTTASRA
AVPLMQPQLQRQVPLTTSSPQTQPFGLSTAPLPQPSVSSELFILQELEKQLLDDDDDDEP
VAAMSGTGSAVTNSEWEETIQQLSSIAAAPSPGLPAAATPNNNNNNVGMTRSPSNSSTAS
SSASCSPPTPGAASRQLLSEAAVAIADGHHEAAAAHLAALKRAANQHGDAEQRLIAMMVA
ALSSRIAPAASAPSQLLADLCSVEQRAGSQLLQDLSPCFRVALHAASAAIVEAVGDHRAI
HLVDFDVSFPQHAALIQYLADRRVQGRSLKVTAVTDPSSPFTQSLTASLPAIEERLKKLA
ERAGVEYRFTVVSCRAAELDASRLCCEPGEAVAVNLAFALSHVPDESVSPANPRDELLRR
VRALGPQVVTLVEQELNTNTAPLAARFTDACAHYGAILESLDATLAREIAEKARAEAALS
KKAANAVGRDGPDRLERCEVFGKWRARFGMAGFRPVSLGSSIAEELVGARVGHVPPGFTV
KAENGVLRFCWMGRAVTVASAWR*

MEPGAPWRGPRQGYAYGVGSATAMQMQLQERADAAAGGGVLKRSLGELERWQHQQQHVAA
QQALYLRAVRQRTAAAVDIAALLGGIPSQVVPGSSFGGGLASPSSTLSSLTTASRAAVPL
MQPQPQRQGPLMTSSPQTQAFGLSRAPLPQPSVSSDLFILQELEKQLLDDDDDDNEPVAA
MSGTGSAVTNSEWEETIQQLSSIAAAPSPGPPAAATPTNNNNNNVGMTRSPSNSSSSTAS
SSASCSPPTPGAASRQLLSEAAVAIADGNHDAAASHLAALKRAANQHGDAEQRLIAMMVA
ALSSRIVPAASAPAQHLAELCGFEQRAGSQLLQDISPCFRVALHAASVAIVDAVGDHRAI
HLVDFDVSLPQHAALIQYLADQPVQGRSLKVTAVTDPSSPFTQSLTASLPAIGERLKKLA
ERAGVEYRFKVVSCRAAELDASRLCCEPGEAVAVNLAFALSHVPDESVSPANPRDELLRR
VRALGPQVVTLVEQELNTNTAPLAARFTDACAHYGAILESLDATLGRETAEKARAEAALS
RKAANAVGRDGPDRLERCEVFGKWRARFGMAGFRPVSLGSSIAEQMVAPRVGPVPPGFTV
KAENGVLRLCWMGRVVTVASAWR*

Other information
Ka divergence:-0.247683KaKs divergence:-0.0955463
GC content 1 (%):69GC content 2 (%):69GC content divergence:0
Length 1 (bp):1872Length 2 (bp):1872Length divergence:0
MFE 1 (kcal):-967.71MFE 2 (kcal):-963.1MFE divergence-0.002