Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G109967-GRMZM2G124313
Species:maize
Duplication type:WGD
Function (paralog1):LOC100281305
Function (paralog2):CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.011656000593788
Log2 mRNA fold difference:-0.5664234227042
Log2 TE fold difference:0.56205359092586
Sequences
Protein sequence

MPTSVATHASLLLKAAAAKPCFSARAAARIPAPSHRPRPPAGRRLPTTVAALAAAARRFR
WPSAAASARGLCAAPHFGGEGMGSDAGAGGRKRRVPAVNGLAKDAPAVNGMRKEEPVAAP
PRLLTLPTVLTIGRVAAVPLLISTFYMEGPWAAMATTGIFLAAAVTDWLDGYIARKMQLG
TPFGAFLDPVADKLMVAATLVLLCTKPLESSLLNDGPWLLTVPSIAIIGREITMSAVREW
AASQNSKVLEAVAVNNLGKWKTATQMTALTLLLASRDPSLPAQGALVAPGVALLYVSTGL
AVWSLVVYMRKIWRILLK*

MRLRPTPPQPQPTHKSREWCEKSIRPMPTSVATHATLLIKAAAAKPFFSPRPAARIPAPS
PHPPPPPAGRRLPNTAAALAAAARRFRWPSAAASARGLCAPPHSGGEGMGSDAGAGARKR
RDSAVNGLAKDVPPVNGMMMPKEEPATAPPRLLTLPTVLTIGRVAAVPLLISTFYMEGPW
AATATTGIFLAAAVTDWLDGYIARKMQLGTPFGAFLDPVADKLMVAATLVLLCTKPLETS
LLNDGPWLLTVPSIAIIGREITMSAVREWAASQNSEALEAVAVNNLGKWKTATQMTALTL
LLASRDPSVPAQGALVAPGVALLYISAGLAIWSLVVYMRKIWRTLLK*

Other information
Ka divergence:0.072931KaKs divergence:0.332931
GC content 1 (%):59GC content 2 (%):60GC content divergence:0.008
Length 1 (bp):957Length 2 (bp):1044Length divergence:0.043
MFE 1 (kcal):-403.1MFE 2 (kcal):-425.8MFE divergence0.027