Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G110023-GRMZM2G150598
Species:maize
Duplication type:WGD
Function (paralog1):ATP-dependent Clp protease ATP-binding subunit clpA
Function (paralog2):hypothetical protein LOC100274511

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.2960162541505
Log2 mRNA fold difference:1.769671931622
Log2 TE fold difference:-1.4637738204752
Sequences
Protein sequence

MATAAHQVAATFLSFLSSSTHHLAPSSVSLGTTSVLPVSLRAAGTRGPRLAYRLRGRRVG
AAVAQLPTTHPEVVSGEKKIRWSSRAVRSFAMAELEARKMRYPTTGTEGLLMGILVEGTS
GAAKLLRANGITLLKVREEAANVLGKSEMFYFSPMHPPLTEAAQRALDWAVNEKLKSGED
GEVNANHLLLGIWSDDESAGHKILYSLGFDDVKASLLAKTADEEAAMSPR*

MATADRVAATFLSSFPTHHPRPFSSVSLVTNPVLPVSLRAAVTGGPRLASRLRVHRVGAA
VAQLPTTNPEVASGEKKIRWSSRAVRSFAMAELEARKMRYPTTGTEGLLMGILVEGTSGA
AKLLRANGTTLLKVREEAANVLGKSEMFYFSPMHPPLTEAAQRALDWAVNEKLKSGEDGE
VTANHLLLGIWSDKESAGHKILYSLGFDDEKASLLAKTAGEEAAMSLREQGEHLIYSST*

Other information
Ka divergence:0.159269KaKs divergence:-0.0259439
GC content 1 (%):55GC content 2 (%):54GC content divergence:-0.009
Length 1 (bp):693Length 2 (bp):720Length divergence:0.019
MFE 1 (kcal):-273.04MFE 2 (kcal):-265.86MFE divergence-0.013