Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G110044-GRMZM2G156246
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100381468
Function (paralog2):LOC100283873

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

FTRSAQPQSHRLASQSYSHCRTHPSPSSSGLALPSRRSPRPAAATRPASIAMTTSRRLAD
RKIARFEKNITKRGSVPETVKKANDYPVGPILLGFFVFVVVGSSLFQIIKTASNAGLF*

QTRAGPGNSRTSRAHRHRQAHSAITVSPRSRTHGLAHTRPHPLPVSPSPPSTAASGRGNP
TCVNRHGVLLIGRYHDLRRISQRGALFLRQPRRQTIILLGLFFLGSLSSWLLDHLSFRSS
RQHQTLVYSEVNRLTHAVCH*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):54GC content 2 (%):55GC content divergence:0.009
Length 1 (bp):357Length 2 (bp):423Length divergence:0.085
MFE 1 (kcal):-98.41MFE 2 (kcal):-136.23MFE divergence0.161