Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G110057-GRMZM2G128215
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):F-box protein interaction domain containing protein

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.16238322938396
Log2 mRNA fold difference:1.8468634403676
Log2 TE fold difference:-2.1579858914774
Sequences
Protein sequence

MDGEMDEDALTEILARLPCRSLARFQCVSTSWRRIISSDYLRRRLPLITSGVLYHDDTCR
GGADGGRRQQVYTYACASGGGATATATATAEAPDMGFFPRHDTSTIIDGCNGLLLYYASR
PTAAFHVVNPTTRRWAELPAPRARTLLSVLAFDPCASPRYRVVCFTGWLPRGATLEVFDS
ERGAWTDHEVDFGLDTDAMSATMHYSGGALHVLAYSGHVVRVDLDTMASAATELPAPVSC
RARAGHCRGRLRFASSDGARLRIWELRDATGGEWALKHEIGVADVVPGAASQPITFLFMA
FHPEREVVYLWSPWKLLAFDMVQRRVEEEWAFGSEKEGTHLIQVWLFPFSRHLASALA*

MDGEMDEDVLTEILARLPCRSLARFQCVSTSWRRIISSDYLRRRLPLITSGVLYHDGGRR
QQSYTYACASGGGGGGGAMAEAADMRFFPRHETSTIIDGCNGLLLYYASRPAAFHVVSPT
TRRWAELPAPRAMTLLSVLAFDPRASPRYRVVCFTGWLPRGATVEVFDSERGAWRGHELD
FGLGTDAMSASMHYAAGALHVLAYSGHVVRVDLDTMACAVTPLPAPVSCRARAGHCRGRL
RFASSDGQRLRIWELQDAAAGEWALKHEIGVSDVVPGDAASQPITFLFMAFHPDRELVYL
WSPWKLLAFDLVERRVQEWVFGSEKEGTHLIQVWLFPFSRHLANALA*

Other information
Ka divergence:0.109554KaKs divergence:0.206371
GC content 1 (%):71GC content 2 (%):71GC content divergence:0
Length 1 (bp):1077Length 2 (bp):1044Length divergence:-0.016
MFE 1 (kcal):-573.1MFE 2 (kcal):-547.6MFE divergence-0.023