Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G110141-GRMZM5G808899
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100276062

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-1.642927374422
Log2 mRNA fold difference:-1.2455397704365
Log2 TE fold difference:-0.38464000060247
Sequences
Protein sequence

MAAPSWIRLRQARATLLILLLLALNISLSSAANFEGFDSDDLPSAAGGLDADDDEEGLDG
VDLPPPPPISLSTSAPSPPVTTTSAPNPNPATRTPRDPTPALDLWDEDEFEGIPVPEAIP
SDDSAAPAEAGQSDPSAEAPAEAIPAAKRSPAELLRAFSVEIACVSFLICFVLNYFTGKR
QNENIALAWATKFATRDSIFDKNFSLLGTGDGKDTPLLLKEGQDVFKFYASGRRFCQGML
ATMEMRARHDLLSRFVELVFPGKDTITFEVVMNEEAMDHVVLAVARKKAAKTLQKEERDL
QRFANVITSAPAGRKWVSDELAVVAESKEVAGDMITEAVLDQVLGEKAFEKFGKWFISLR
FSDQLAGSYKKVLAFKFVLPDASNMSEMTRLVALVPYYIDLVGRYKLSSHARSKTDGART
KAAQEAFRELQSARQEALQRKKAEKKKLIEEADAKLSAESLRKKEEKERARQMKKSGPKV
KMLRS*

MAALSWIRLRPPRAAILILLLLALNISPSFAANFEGFDSDDLPVAAGGLDADDDEGLDGV
YLPPPPPISLSTSAPSPPVTTTPAPNPNPATPTPRDPTPALDLWDEDEFEGIPVPEAIPS
DDSAAPAEVDPSDPSAEAPVEVAPAAKRSPAELLRAFSFEIACASFLVCYVLNYFTGKRQ
NENIALAWATKFATRDSIFDKNFSLLGTGDGKDTPLLLKEGQDVFKFYASGRRFCQGLLA
TMEMRARYDLLSKFVELVFPRKDTITFEVIMNEEAMDHVVLAVARKKAAKTMHKEERDLQ
RFASVLTSAPAGRKWVSDELAVVAESKEVAGDMITEAVLDQVLGEKTFEKFGKWFISLHF
SDQLAGSYKKVLTFKFVLPDASNMSEMTRLVSLVPYYIDLVGRYKLSSHARSKTDGARTK
AAQEAFRELQSARQEALQRKKAEKKKLMEETDAKLSAEALRRKDEKERARQLKKSGPKVK
MLRS*

Other information
Ka divergence:0.19568KaKs divergence:-0.080137
GC content 1 (%):58GC content 2 (%):57GC content divergence:-0.009
Length 1 (bp):1458Length 2 (bp):1455Length divergence:-0.001
MFE 1 (kcal):-572.92MFE 2 (kcal):-559.4MFE divergence-0.012