Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G110143-GRMZM2G016296
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191156
Function (paralog2):hypothetical protein LOC100272438

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MSHFGRTGPPDIRDTFSLLVLNISFRTTADDLFPLFERCGKVVDVFIPRDRRTGDSRGFA
FVRYKYADEAQKAIDRLDGGFFFDCAPHVGILELLFLIIVDFLGAGRNVDGRNIMVQFAK
YGPNAVPIHKGRVKEGVEKSRDRSRSRSPRPRHRDRDDRRRSRSRSRSRERHVHDRDRDY
RRRSRSRSRSMSSSPDHKSHRRARDDVKRKSRSKSRSRSRSRSRSYHSSSPARRSASPPK
SPPPQRSPTPEKHANGKDSPLSRSVSPSPKRASSRSPGSDSKE*

MSHFGRSGPPDIRDTFSLLVLNISFRTTADDLFPLFERYGKVVDVFIPRDRRTGDSRGFA
FVRYKYADEAQKAIDRLDGRDVDGRNIMVQFAKYGPNAEPIRKGRVKEGVEKSQDRSRSR
SPRPRHRDRDHRSQSRSRSRERHVRDRDRGYRRRSRSRSRSLSSSPDNRSHHRARDDDKR
KSMSKSRSRSRSTSRSRSYYSASPARHSASPRKSPPPQRSPTPAKHANGKVAPLSRCVSP
LPKRATSRSPGSDGKVRLMSNCLLCSLLPMHLFM*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):54GC content 2 (%):55GC content divergence:0.009
Length 1 (bp):852Length 2 (bp):825Length divergence:-0.016
MFE 1 (kcal):-283.31MFE 2 (kcal):-295.62MFE divergence0.021