Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G110145-GRMZM2G122277
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100382337

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.15310324909084
Log2 mRNA fold difference:0.55017674850463
Log2 TE fold difference:-0.3936632008146
Sequences
Protein sequence

MAAGQQQASGGAKHGCVCGFPVCACAGAAAVASAASSADMDRVAVAATEGQIGAVNDESW
IAVDLSDDGLSADGADPGVALEDRPVFRTEKIKGVLLHPYRVLIFVRLIAFTLFVIWRIS
HRNPDALWLWVTSIAGEFWFGFSWLLDQLPKLNPINRVPDLAALRQRFDRAGGGAGGGTS
LLPGLDVFVTTADPFKEPILSTANSVLSILAADYPVERNTCYLSDDSGMLLTYEAMAEAA
KFATVWVPFCRKHGIEPRGPESYFDLKSHPYMGRSQEDFVNDRRRVRKDYDEFKARINGL
DHDIKQRSDAYNAARGLKDGEPRATWMADGTQWEGTWVEPSENHRKGDHAGIVLVLLNHP
SHSRQLGPPASADNPLDLSMVDVRLPMLVYVSREKRPGHNHQKKAGAMNALTRCSAVLSN
SPFILNLDCDHYINNSQALRAGICFMLGRDSDTVAFVQFPQRFEGVDPTDLYANHNRIFF
DGTLRALDGMQGPIYVGTGCLFRRITLYGFDPPRINVGGPCFPALGGMFAKAKYEKPGLE
LTTTKAAVAKGKHGFLPMPKKSYGKSDAFADTIPMASHPSPFAAASAASVVADEATIAEA
VAVCAAAYEKKTGWGSDIGWVYGTVTEDVVTGYRMHIKGWRSRYCSIYPHAFIGTAPINL
TERLFQVLRWSTGSLEIFFSRNNPLFGSTFLHPLQRVAYINITTYPFTAIFLIFYTTVPA
LSFVTGHFIVQRPTTMFYVYLAIVLGTLLILAVLEVKWAGVTVFEWFRNGQFWMTASCSA
YLAAVCQVLVKVVFRRDISFKLTSKQPAGDEKKDPYADLYVVRWTWLMVTPIIIILVNII
GSAVAFAKVLDGEWTHWLKVAGGVFFNFWVLFHLYPFAKGILGRHGKTPVVVLVWWAFTF
VITAVLYINIPHIHGPGGKHGGAIGRHGGDAHHHGKKFDGYYLWP*

MAPGGRRSNGETPTGQQQQQQQADGRRGCACGGFPVCACAGAAAVASAASSADMDRVAVA
ATEGQIGAVNDESWVAVDLSDDGLSSAADPGAVALEERPVFRTEKIKGVLLHPYRVLIFV
RLIAFTLFVIWRISHRNPDALWLWVTSIAGEFWFGFSWLLDQLPKLNPINRVPDLGALRQ
RFDRADGTSRLPGLDIFVTTADPFKEPILSTANSILSILAADYPVERNTCYLSDDSGMLL
TYEAMAEAAKFATVWVPFCRKHGIEPRGPESYFELKSHPYMGRSQEDFVNDRRRVRRDYD
EFKARINGLENDIRQRSDAYNAARGLKDGEPRATWMADGTQWEGTWVEPSENHRKGDHAG
IVLVLLNHPSHSRQLGPPASADNPLDLSMVDVRLPMLVYVSREKRPGHNHQKKAGAMNAL
TRCSAVLSNSPFILNLDCDHYINNSQALRAGICFMLGRDSDTVAFVQFPQRFEGVDPTDL
YANHNRIFFDGTLRALDGMQGPIYVGTGCLFRRITLYGFDPPRINVGGPCFPSLGGMFAK
TKYEKPGLELTTKAAVAKGKHGFLPMPKKSYGKSDAFADTIPMASHPSPFAAAAAVVAEE
ATIAEAVAVCAAAYEKKTGWGSDIGWVYGTVTEDVVTGYRMHIKGWRSRYCSIYPHAFIG
TAPINLTERLFQVLRWSTGSLEIFFSRNNPLFGSTFLHPLQRVAYINITTYPFTAIFLIF
YTTVPALSFVTGHFIVQRPTTMFYVYLAIVLGTLLILAVLEVKWAGVTVFEWFRNGQFWM
TASCSAYLAAVCQVLVKVVFRRDISFKLTSKQPAGDEKKDPYADLYVVRWTWLMVTPIII
ILVNIIGSAVAFAKVLDGEWTHWLKVAGGVFFNFWVLFHLYPFAKGILGRHGKTPVVVLV
WWAFTFVITAVLYINIPHIHGPGGKHGGAIGKHGAAHHGKKFDGYYLWP*

Other information
Ka divergence:0.0097254KaKs divergence:0.140022
GC content 1 (%):67GC content 2 (%):67GC content divergence:0
Length 1 (bp):2838Length 2 (bp):2850Length divergence:0.002
MFE 1 (kcal):-1398.4MFE 2 (kcal):-1388.16MFE divergence-0.004