Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G110309-GRMZM2G063151
Species:maize
Duplication type:WGD
Function (paralog1):Initiator-binding protein 2Putative uncharacterized protein ;
Function (paralog2):Initiator binding protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MVFQKRSSSELEASGGGQVAEMPRVPKSARGKRSVRKKEAQNPPQMSAFDLLATVAGKLL
DEGVGSLGNMSAGAPALTACAKDVRVKKEQCDEEMKQFKHEVTDQDSCNESAILPHIVFQ
RAVNNARNEDPKAKSEAQDKESSMISCTKAELGCNFGVIADRWSPESVESGAFTGDAVAS
LMPPAPAGFHKNAPEMYNLLDSMDVDVKPPPLVSSDSTGEMPLYGDKVHRSTSLPRVSKG
VGFFAVDRDDDDDKSSGCTHPSTTTNKDFRSNCTAEYSRVRKLLTSKYRKVAPARVYKSD
LSYSDVDRKPSFRNKKMHYTRQRTQRSTFKRRKLFDRHSVLASEFGTAHGKGNTKKVTGR
DSHAVSLEANKGTSSTPFQKSRGSNDCHVKLKIKSFKVPELLVEIPESATVGSLKKTVLE
AVTAILGGGLRVGVLHHGKKVRDDNKTLIQAGIGQEDMLDNLGFSLEPNCTQNPQVQAPE
DISFLETIDTAEPLARIAPADSSSKHGEVDLSQEFALTPLAMNYQGSDHDSVHSPGGVSS
PDKVSTNSRALVPVPAADPNAGAIVPANKSKRSPEQGQRRIRRPFSVAEVEALVLAVEKL
GTGRWRDVKLRAFDNAKHRTYVDLKDKWKTLVHTASISPQQRRGEPVPQELLDRVLAAQA
YWSQQQAKLQPKTPPLLAEARLLT*

MGSCRFGSGTSHEQRNHQLLTNPLLNFKQPKPRAEMVFQKWSSSSEMESCGGGQVPEMPR
VPKSARGKRSVRKKEAQSPAQMSAIDLLATVAGKLFDEGAGSLGNTSAGAPALAAFAKDA
LVKQEQCDEQMKLFKHEATDQDSCNESAILPHIVLQRVVNNARNEDPKAKSEVQDKESSM
ISYTKAELGCNFGVIADRWSPESVESGAFTGDAVARLMMTAPAGFHKNAPEMYSLLDSMD
VDVKPPPLVSSDSTGEMPLHGDKIHRSTSLPRAPKGVGFFAVDRDDDDDKSSGCTHPSTA
TNKDFTSNCKAEYNRVRKLLTSKHRKVAPARIHKSDLSYSDVERKPSFRYKKMHTRQRTQ
RSTFKRRKLFDRHLALASEFGTANGKGNTKVAGRNSNAVSLEANKGTNSMPFQKSCGSND
CHVKLRIKSFNVPELLVEIPDSATVGSLKKTVLEAVTAILGGGLRVGVLHHGKKVRDDSK
TLIQAGIGQDDMLDNLGFSLEPNCTQNPQVQAPEDVSFLENIDTTEPLARITPADSSSKL
GEVDVSQELALTPLAMNYQGSDHDSVHSPGAVSSRDKDSRALFLVPAADPNAGAVVPANK
TKRSPEQGHRRIRRPFSVAEVEALVLAVEKLGTGRWRDVKLRAFDNAKHRTYVDLKDKWK
TLVHTASISPQQRRGEPVPQELLDRVLAAQAYWSQQQAKLQPKTPSLAEARLLTQ*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):51GC content 2 (%):51GC content divergence:0
Length 1 (bp):2055Length 2 (bp):2148Length divergence:0.022
MFE 1 (kcal):-718.21MFE 2 (kcal):-756.42MFE divergence0.026