Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G110333-GRMZM2G018398
Species:maize
Duplication type:WGD
Function (paralog1):ethylene response element binding protein
Function (paralog2):LOC100282307

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MCGGAILANLREPAPRRLTERDIWQQKKKLKRGGGGGRRSFAAEDDEDFEADFEVFEADS
SDSDLELREGTDDDVVEIKPFTAKRTFSSDGLSTMTSAVARSAKRKRKNLYRGIRQRPWG
KWAAEIRDPQKGVRVWLGTFNSPEEAARAYDAEARRIRGKKAKVNFPDAPAVGQKHRSGS
ASAKASKSSFGQKPIVKVAMNNLANTNASFFQSASYPSNLFVQHGNMPFVPAMNSTASVD
DLIMNLHSDQGSNSFGCSDLGWENDTKTPDITSIAPISTIAEGDESAFVDSNSNSSFVLP
ALENSAVDLTDGLTDLESYMRFLLDGGPSDSVDSLLNLDGSQDVGSDMDLWSFDDMPIVG
DFF*

MCGGAILAELREPAPRRLTERDIWQQKKKPKRGGAGGRRSFAAEDDEDFEADFEDFEADS
GDSDLELGEGADDDVIEIKPFAAKSTFSRDGLSTMTTAGYDAPAARLAKRKRKNQYRGIR
QRPWGKWAAEIRDPQKGVRVWLGTFNSPEEAARAYDAEARRIRGKKAKVNFPDAPAVGQK
CRSSSASAKALKSCVEQKPIVKTDMNILANTNAPFYQSVNYASNNPFVPAMNSTVSFEDP
IMNLHSDQGSNSLGCSDLGWENDTKTPDITSIAPIPTIAEGDESVFVNSNSNSSMVPPVL
ENNAVDLTDGLTDLESYMRFLMDGGASDSIDSLLNLDGSQDLGSNMDLWTFDDMPIAGDF
F*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):52GC content 2 (%):52GC content divergence:0
Length 1 (bp):1092Length 2 (bp):1086Length divergence:-0.003
MFE 1 (kcal):-396.53MFE 2 (kcal):-394.41MFE divergence-0.003