Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G110345-GRMZM2G126812
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.010529002926
Log2 mRNA fold difference:1.0473513848599
Log2 TE fold difference:-2.1558692985713
Sequences
Protein sequence

MVACSRGLAWPPFDLTTARGAASWPRRRAAIRCCCAGADAQPQRRLSRAAAVAPERAEEW
RIDGNKPSAAAPGRRRTSLTAMPPLPFPAPRSRRQVKQPDFYPRCTPRGSAPQSRDTPPK
RDTGIASEKEWGINLLDEAVKESGINEDGSTWYRESGDDIGENGYRCRWARMGGQSHDGS
TEWKETWWEKSDWTGYKELGAEKSGRNAEGDSWWEKWKEVLYQDEWSQKLEQSHLRGSDI
VYLVEYSNLARIERSAEKQAKSGIENAGWYEKWWEKYDAKGWTEKGAHKYGRLNEQSWWE
RWGEHYDGRGFVLKWTDKWAETDLGTKWGDKWEEKFFAGIGSRQGETWHVCPGGERWSRT
WGEEHFGNGKVHKYGKSTTGERWDLVVDEETYYEAEPHYGWADVVGDSTQLLSIQPVERP
PGVFPAIDFSSAPPPKDAPPGMPPSPLD*

MAACSRGLAWPPFDLTTARGAASWPRRRATIRCCCAGTDPEPRRRLSRAAAAAPERAEEW
RVDGNKPSAAAPARRRASLTAMPPLPFPAPRIVLEDSSSNRTSTHGARRGARLLNPVIPH
PREISDLLRKCMCLFGTCLIDTGIASEKEWGINLLDEAVKESGINEDGSTWYRESGEDTG
ENGYRCRWARMGGQNHDGSTEWKETWWEKSDWTGYKELGAEKSGKNAEGDSWWEKWKEVL
YQDEWSNLARIEKSAEKQAKSGAENAGWYEKWWEKYDAKGWTEKGAHKYGRLNEQSWWER
WGEHYDGRGFVLKWTDKWAETDLGTKWGDKWEEKFFAGIGSRQGETWHVSPGRERWSRTW
GEEHFGNGKVHKYGKSTTGESWDLVVDEETYYEAEPHYGWADVVGDSTQLLSIQPVERPP
GVFPAIDFSSAPPPKDAPPGMPPSPLDGGN*

Other information
Ka divergence:0.430223KaKs divergence:0.342532
GC content 1 (%):56GC content 2 (%):56GC content divergence:0
Length 1 (bp):1347Length 2 (bp):1353Length divergence:0.002
MFE 1 (kcal):-502.81MFE 2 (kcal):-532.72MFE divergence0.029