Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G110500-GRMZM2G034260
Species:maize
Duplication type:WGD
Function (paralog1):mediator complex subunit 10 CG5057-PA
Function (paralog2):mediator complex subunit 10 CG5057-PA

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MENVAANPSAAAAAAGNGVQASGAGGERPEDASKQNLAQVTSSIQKTLGLLHQLNLTVSS
FNSASQLPLLQRLNALVAELDTMQKLAEGCNIQVPMEVVNLIDDGKNPDEFTRDVLNSCI
AKNQITKGKTDAFKSLRKHLLEELEQAFPEDVEAYREIRATSAAEAKRLAQSHGNLLNGD
VKVKAEH*

MQNTVANPSTAAAAAAAGNGGVQASGAGGERPEDASKQNLAQVTSSIQKTLGLLHQLNLT
VSSFNSASQLPLLQRLNALVAELDTMQKLAEGCNIQVPMEVVNLIDDGKNPDEFTRDVLN
SCIVKNQITKGKTDAFKGLRKHLLEELEQAFPEDVEAYREIRATSAAEAKRLAQSQGTLP
NGDVKVKAEH*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):58GC content 2 (%):59GC content divergence:0.009
Length 1 (bp):564Length 2 (bp):573Length divergence:0.008
MFE 1 (kcal):-217MFE 2 (kcal):-225.7MFE divergence0.02