Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G110558-GRMZM2G042179
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100274751
Function (paralog2):LOC732831

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MRVLEEDLFPSTPGKVKIERAGAMNRQLHRCFASTSTMFLWALFLVAMTASYLSFQSFVD
TSSKYLAASWGGLHWERQIRASAAPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRKRG
DGVVGVDNFNAYYDPSLKKARRALLASHGVFIVEGDINDGRLLAKLFDVVPFTHVLHLAA
QAGVRYAMQNPASYVHSNIAGLVTLLEACKDADPQPAIVWASSSSVYGLNDKVPFSERDR
TDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFSFTRNILQGK
PITVYRGKDRVDLARDFTYIDDIVKGCLGSLDTAGKSTGTGGKKRGPAPYRIFNLGNTAP
VTVPNLVSILEKHLRVKAKKNVVEMPGNGDVPFTHANITLARQQLGYKPTTNLDVGLKKF
VKWYQSYYGYTRGSKNSRQ*

MRVLEEDLFPSTPGKVKIERAGAMNRQLHRCFASTSTMFLWALFLVAMTASYLSFQSFVD
TSSKYFAASWGGLHWERQIRASAVPRRPPGSAAGAGMSVLVTGAAGFVGTHCSLALRRRG
DGVVGVDNFNAYYDPSLKKARRALLASHGVFVVEGDINDGRLLAKLFDVVPFTHVLHLAA
QAGVRYAMENPASYVHSNVAGLVTLLEACKDADPQPAIVWASSSSVYGLNDKVPFSERDR
TDQPASLYAATKKAGEEITHTYNHIYGLSITGLRFFTVYGPWGRPDMAYFSFTRNILQGK
PITVYRGKDHVDLARDFTYIDDIVKGCLASLETAGKSTGTGGKKRGPAPYRIFNLGNTSP
VTVPNLVSILEKHLRVKAKKNVVEMPGNGDVPFTHANISLAREQLGYKPTTNLDVGLKKF
VKWYLSYYGYTRGGSKNSRH*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):66GC content 2 (%):66GC content divergence:0
Length 1 (bp):1320Length 2 (bp):1323Length divergence:0.001
MFE 1 (kcal):-589.77MFE 2 (kcal):-595.9MFE divergence0.005