Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G110572-GRMZM2G140537
Species:maize
Duplication type:WGD
Function (paralog1):Putative uncharacterized protein
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.34741392107093
Log2 mRNA fold difference:0.22825136810237
Log2 TE fold difference:0.1172439265315
Sequences
Protein sequence

MDSSGEELLKKIRELEVGQAQLKQEMSKLIPGAGERRRSQSVSPRRGVPVPPPPPAKAKA
GAPGRRLSGGFEGGQRAWARGSASFPHSSPLQREGRAGAGDASTSARLPERQYSRVLQSM
GQSVHILDLDGRIIYWNQSAENLFGYPASEALGQDALMLLVDSHDHNAVNNIFQRISMGE
SWTGKFPVKNKQGHRFSAVATNTPFYDEDGSLMGFICVSSDSRQLEQIFCKPPTSARSQS
ESSMTSCDGSCSNTSHRINSLNRSSFDSNLPLQSTLASKITNLATKVTNKVRSRVRTDEN
DDGGSGESHCLDRGAKEEPTSSGTSTPRGDAPHGPFATEENSPGKSTNPNSDESEGKVGL
HKILGSKAEALLNKKGISWPWKGRENEGPDERNHVILPWLHGGQENGVNHQKVSDSSISP
DAQGAEHNQPSKNEASGSWSSFNNNSTGSASSTGSTNSSALYKVDHEADCLDYEILWEDL
VIGEQIGQGSCGTVYHALWYGSDVAVKVFSKQEYSEEVILTFRQEVSLMKKLRHPNILLF
MGAVMSPQRLCIVSEFLPRGSLFRLLQRSATKLDVRRRVHMALDIVRGMNYLHHSSPPII
HRDLKSSNLLVDKNWIVKVADFGLSRLKRETFLTTKTGKGTPQWMAPEVLRNEPSDEKSD
VYSYGVILWELVTQKIPWENLNSMQVIGAVGFMNQRLDIPSEVDPQWKSIILSCWESDPQ
QRPSFQELLERLRELQRHYAIQHRNTKNSIEE*

MDSSGEELLKKIRELEVGQAQLKQEMSKLIPGAVERRRSQSVSPRRGAPVPPPTKAKAGP
PGRLLSGGFEGGQRAWARGSASFPHSSPLHREGRATGAGNGSTSARLPERQYSRVLQSLG
HSVHILDLDGRIIYWNQSAENLFGYPASEALGQDALMLLVDSGDHNVVNDIFRRISMGES
WTGKFPVKSKQGDRFSAVATNTPFYDEDGSLVGIICVSSDSRHLEQIFCKPPTSARPQSE
SSRTSCDGSCSNTSRRINLLNRSPFDPQIPLQSTFASRITNLATKVTNKVRSRVSTDDYG
IEREGGSGESHCSDRGAKEEPTSSGTNTPRGNAPHGPFSTDENSPGKSTNPSSDELEGKV
GLHKFLSSKAEALLNKKGISWPWKVRENDGPDERNHVILLHGDQENVMNHQKVSDSSIAP
DSQGAEHNLPSKNEASGSWSSYNNNSTSSASSTGSTNSSALYKVDHEADCLDYEILWEDL
VIGEQIGQGSCGTVYHALWYGSDVAVKVFSRQEYSEDVILSFRQEVSLMKKLRHPNILLF
MGAVTSPQRLCIVTEFLPRGSLFRLLQRSATKLGVRRHVHMALDIARGMNYLHHSSPPII
HRDLKSSNLLVDKNWTVKVADFGLSRLKRETFLTTKTGKGTPQWMAPEVLRNEPSDEKSD
VYSYGVILWELVTQKIPWENLNSMQGFAATIFFKIMLVWVASTIPNCRGYAPISVGHWRS
RFYEPKVGYPKRSRSSVEINYPELLGKRPAATAVVPGASGEAPRAAEALRHPAAEREEQR
RGVKTEECNATLPSGGGLALKHFASQQHARSREGPEPPVLGPGGC*

Other information
Ka divergence:0.4258KaKs divergence:0.345621
GC content 1 (%):50GC content 2 (%):50GC content divergence:0
Length 1 (bp):2259Length 2 (bp):2478Length divergence:0.046
MFE 1 (kcal):-819.64MFE 2 (kcal):-889.16MFE divergence0.041