Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G110922-GRMZM2G334791
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100384302
Function (paralog2):

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-2.3599168598948
Log2 mRNA fold difference:-3.5504396949538
Log2 TE fold difference:1.1911382718284
Sequences
Protein sequence

MDKYEAVRDIGSGNFGVARLMRNRETRELVAVKCIERGHRIDENVYREIINHRSLRHPNI
IRFKEVILTPTHLMIVMEFAAGGELFDRICDRGRFSEDEARYFFQQLICGVSYCHYMQIC
HRDLKLENVLLDGSPAPRLKICDFGYSKSSVLHSRPKSAVGTPAYIAPEVLSRREYDGKW
YLFMQLADVWSCGVTLYVMLVGAYPFEDPDDPKNIRNTIQQIMQVQYKIPDHVHISTECQ
QLIARIFVANPMRRITMKEIKSHPWFLKNLPRELTETAQGMYYRRDNRVPSYSDQTSEEI
MKIVQDARTMPKSSRSGYGWSSEYSDEEEEKEEEHRPEEHEEEEDEYDRRVKEVHASGEL
RMDALHI*

MDKYEAVRDIGSGNFGVARLMRNSETRELVAVKCIERGYRIDENVYREIINHRSLRHPNI
IRFKEVILTPTHLMIVMEFAAGGELFDQICDRGRFSEDEARYFFQQLICGVSYCHYMSSV
LHSRPKSAVGTPAYIAPEVLSRHEYDGKLADVWSCGVTLYVMLVGAYPFEDPDDPKNIRK
TIQQIMQVQYKIPDYVHISTECQQLIARIFVANPVRRITMKEIKSHPWFLKNLPRELTET
AQGMYYRRDNKVPSYSDQTSEEIMKIVRDARTMPKSSRSGYGWSAEYSDEEEKEEEHRLE
EDEYDRRVKEVHASGELRSSGMYAVLASELLVLGQFSCNIIQYTEADYHVLVLTSTTERR
TAVALAARHQRPARGPDDWTAKAVVATGKRRYAARPFYRCSCGKWNLGFGSTMVHVCKSH
H*

Other information
Ka divergence:0.721915KaKs divergence:-0.999555
GC content 1 (%):49GC content 2 (%):51GC content divergence:0.02
Length 1 (bp):1104Length 2 (bp):1266Length divergence:0.068
MFE 1 (kcal):-363.62MFE 2 (kcal):-420.61MFE divergence0.073