Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G111172-GRMZM2G156110
Species:maize
Duplication type:TD
Function (paralog1):40S ribosomal protein S15
Function (paralog2):40S ribosomal protein S15

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.2395151862403
Log2 mRNA fold difference:0.56635446858923
Log2 TE fold difference:-0.32491968838377
Sequences
Protein sequence

MADVDVEPEVAAGAPKKRTFRKYSYRGVDLDALLDMSTDDLVQLFPARARRRFQRGLKRK
PMALIKKLRKAKKDAPAGEKPEPVKTHLRNMIIVPEMIGSIVGVYNGKTFNQVEIKPEMI
GHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK*

MADVDVEPEVAAGAPKKRTFRKYSYRGVDLDALLDMSTDDLVQLFPARARRRFQRGLKRK
PMALIKKLRKAKKDAPAGEKPEPVKTHLRNMIIVPEMIGSIVGVYNGKTFNQVEIKPEMI
GHYLAEFSISYKPVKHGRPGIGATHSSRFIPLK*

www.000webhost.com

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):56GC content 2 (%):56GC content divergence:0
Length 1 (bp):462Length 2 (bp):462Length divergence:0
MFE 1 (kcal):-156MFE 2 (kcal):-159.32MFE divergence0.011