Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G111232-GRMZM2G155991
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):protein phosphatase 2C

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:2.4061399321145
Log2 mRNA fold difference:2.0240236181989
Log2 TE fold difference:0.34341572292128
Sequences
Protein sequence

MVGRMERQTASSSASCSSSSSSSSVCGGKKRPDILNMIRNAACLNSSSTDTGKGRSKLST
NKVTHGFHLVEGKSGHGMEDYHVAEYKYVKNHELGLFAIFDGHLGDKVPSYLKANLFSNI
MKEPLFWSSPEEAIKNAYCSTNKYILENGKQLGPGGSTAVTAIVVDGKDMLIANVGDSRA
VVCEMGSANQLTVDHEPDTTEERQRIEKHGGFVTTFPGDVPRVNGQLAVARAFGDQSLKA
HLSSKPDTRHVPIDSSIEFVILASDGLWKVMKNQEAVDLVKSIKDPKAAAKRLTTEALAR
KSKDDISCIVIRFRC*

MVGRMERQTASSSASCSPAAAATTSSSSCGGKKRPDILNMIRNASCLNSSSADTGKGRSK
LSTNKVTHGFHLVEGKSGHDMEDYHVAEYKYVKNHELGLFAIFDGHLGDKVPSYLKANLF
SNIMKEPLFWSSPQEAIKNAYCSTNKYILENTKQLGPGGSTAVTAIVVDGKDMWIANVGD
SRAVVCERGSAKQLTVDHEPHETNERQRIEKHGGFVTTFPGDVPRVNGQLAVARAFGDQS
LKAHLSSEPDISHVPINSSIEFVILASDGLWKVMKNQEAVDLVKSIKDPQAAAKRLTTEA
LARKSKDDISCIVIRFRC*

Other information
Ka divergence:-0.205763KaKs divergence:0.0119645
GC content 1 (%):48GC content 2 (%):48GC content divergence:0
Length 1 (bp):948Length 2 (bp):957Length divergence:0.005
MFE 1 (kcal):-310.6MFE 2 (kcal):-311.65MFE divergence0.002