Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G111324-GRMZM5G824920
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100191471
Function (paralog2):glucan endo-1,3-beta-glucosidase 3

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:0.16300845728171
Log2 mRNA fold difference:0.20302641827536
Log2 TE fold difference:-0.01710764940413
Sequences
Protein sequence

MRKLLFISFVLSLSAAAVHGEDGAYIGVNIGTAMSSVPAPTQITTLLRSQNIRHVRLYDA
DPAMLAALSNTGIRVIVSVPNEQLLAIGNSNATAANWVARNVAAHFPAVNITAIAVGSEV
LSAQPSAAPLLMPAMRYLQNALVAAALDRYIKVSTPHSSSIILDSFPPSQAFFNRSLDGV
LVPMLRFLQSTGSPLMLNVYPYYDYMRSNGVIPLDYALFRPLPPNKEAVDANTLLHYTNV
FDAVVDAAYFAMAYLNVTNVPVMVTETGWPHKGDSSSEPDATSDNADTYNSNLIRHVMNS
TGTPKHPGVAVPTYVYELYDEDTRPGSTSEKYWGLFDMNGVPAYTLHLTGSGVLLANDTT
NQTYCVAREGADPKMLQAALDWACGPGKVDCSVLMQGQPCYDPDTVDAHATYAFNAYYHG
MGMGSGTCYFSGVAVVTTTDPSHGSCVYAGKNGTSLMNGTSLAPSSNSTEGGSGAHRAFG
DVSSLVRIVSTALLFSVVLLLL*

MRKLFFVYFVLLLAAAVVHGEDGAYIGVNIGTAMSSVPAPTQITTLLRSQNIRHVRLYDA
DPAMLAALSNTGIRVIVSVPNEQLLAIGNSNATAANWVARNVAAHFPAVNITAIAVGSEV
LSAQPNAAPLLMPAMRYLQNALVAAALDRYIKISTPHSSSIILDSFPPSQAFFNRSLDSV
LVPMLKFLQSTGSPLMLNVYPYYDYMRSNGVIPLDYALFRPLPANKEAVDANTLLHYTNV
FDAVVDAAYFAMAYLNVTNVPVMVTETGWPHKGDPSSEPDATSDNADTYNSNLIRHVMNS
TGTPKHPRVAVPTYIYELYDEDTRPGSTSEKYWGLFDMNGVPAYTLHLTGSGVLLANDTT
NQTYCVAREGADPKMLQAALDWACGPGKVDCSVLMQGQPCYDPDTVEAHATYAFNAYYHG
MGMGSGTCYFSGVAVVTTTDPSHGSCVYGGKNGTSLMNGTSLAPSSNSTEGGSGAHREFG
DVSSLVRIVSAALLFSALLLL*

Other information
Ka divergence:-0.203851KaKs divergence:-0.362015
GC content 1 (%):66GC content 2 (%):66GC content divergence:0
Length 1 (bp):1509Length 2 (bp):1506Length divergence:-0.001
MFE 1 (kcal):-681.22MFE 2 (kcal):-676.74MFE divergence-0.003