Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G111611-GRMZM5G894156
Species:maize
Duplication type:WGD
Function (paralog1):vesicle transport v-SNARE 13
Function (paralog2):hypothetical protein LOC100192626

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.85124260393683
Log2 mRNA fold difference:-0.55102939445518
Log2 TE fold difference:-0.29090274732798
Sequences
Protein sequence

MSEVFEGYERQYCEASASLSRKCTAASALDGEKKKQKLSEIQSGVEEAESLIRKMDLEAR
NLQPSIKAGLLAKLREYKSDLNNVKSELKRISAPNARQATREELLESGMADTLAVSTDQR
GRLMMTTERLNQSTDRIKESRRTMLETEELGVSILQDLHQQRQSLLHAHTTLHGVDDNIG
KSKKILAAMSKRMDRNKWIIGGIITALVLAILLILYFKLAN*

MSEVFEGYERQYCEASASLSRKCTAASALDGERKKQKLSEIQSGVEEAESLIRKMDLEAR
SLQPSIKAGLLAKLREYKSDLNNVKSELKRISAPNARQATREELLESGMADTLAVSTDQR
GRLMMTTERLNQSTDRIKESRRTMLETEELGVSILQDLHQQRQSLLHAHTTVERTVPLAN
HPDPNNAKSCHAGCWATGVGAALRAEGEAVVDRGAWRAGAEHVGQGRTDSPMPRAAEPPR
G*

Other information
Ka divergence:0.944054KaKs divergence:0.860748
GC content 1 (%):50GC content 2 (%):57GC content divergence:0.065
Length 1 (bp):666Length 2 (bp):726Length divergence:0.043
MFE 1 (kcal):-230MFE 2 (kcal):-284.7MFE divergence0.106