Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G112488-GRMZM2G112524
Species:maize
Duplication type:TD
Function (paralog1):Pathogenesis-related protein 10
Function (paralog2):hypothetical protein LOC100192117

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.81504369943295
Log2 mRNA fold difference:1.6918228444628
Log2 TE fold difference:-0.98155173336794
Sequences
Protein sequence

MASTNSWTVEIASPVAAPRLFRAAVMDWHTLAPKVTSHVVASAHPVEGEGGVGSVRQFNF
TSAMPFGFVKERLEFLDVDKCECKSTLVEGGGIGVAIETAASHVKVESAAGGGCVVKVDS
TYKLLPGVEVQDEITKAKESVTNIFKAAEAYLVANPEAYN*

MASANSWTLEIASPVAPQRLFRAAVMDWHTLAPKVASHVVASAQPVEGDGGVGSVRQFNF
TSVMPFSFMKERLEFLDADKCECKNTLIEGGGIGVAIETATSHIKVEPAAGGGSVVKVES
TYKLLPGVEVKDEIAKAKESVTAIFKGAEAYLVANPDAYN*

Other information
Ka divergence:-0.0470888KaKs divergence:-0.163057
GC content 1 (%):66GC content 2 (%):66GC content divergence:0
Length 1 (bp):483Length 2 (bp):483Length divergence:0
MFE 1 (kcal):-225.2MFE 2 (kcal):-219.1MFE divergence-0.014