Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G112609-GRMZM2G082976
Species:maize
Duplication type:WGD
Function (paralog1):Derlin-2.2 (ZmDerlin2-2)
Function (paralog2):Derlin-2.1 (ZmDerlin2-1)

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAQAVEEWYRQMPIITRSYLTAAVVTTVGCTLEIISPYHLYLNPKLVVQHYEIWRLVTNF
LYFRKMDLDFLFHMFFLARYCKLLEENSFRGRTADFFYMLLFGATVLTGIVLIGGMIPYI
SETFARILFLSNSLTFMMVYVWSKHNPFIHMSFLGLFTFTAAYLPWVLLGFSILVGSSTW
VDLLGMIAGHVYYFLEDVYPRMTGRRPLKTPSFIKALFADDNVVVAQPPNAGIGAGARFG
AIGVDPQAQ*

MAQAVEEWYRQMPIITRSYLTAAVVTTVGCTLEIISPYHLYLNPKLVVQHYEIWRLVTNF
LYFRKMDLDFLFHMFFLARYCKLLEENSFRGRTADFFYMLLFGATVLTSIVLIGGMIPYI
SETFARILFLSNSLTFMMVYVWSKHNPFIHMSFLGLFTFTAAYLPWVLLGFSILVGSSTW
VDLLGMIAGHVYYFLEDVYPRMTGRRPLKTPSFIKALFADDNVVVAQPPNAGIGAGARFG
AMGLDPQAQ*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):49GC content 2 (%):50GC content divergence:0.01
Length 1 (bp):750Length 2 (bp):750Length divergence:0
MFE 1 (kcal):-242.24MFE 2 (kcal):-241.1MFE divergence-0.002