Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G113016-GRMZM5G836628
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100273174
Function (paralog2):hypothetical protein LOC100272395

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0.60665694712572
Log2 mRNA fold difference:1.4588095189901
Log2 TE fold difference:-0.87230704888965
Sequences
Protein sequence

MTTAARERRLPPTLPLATLIGRELRAGGSERPALRYGHAGFAKRGEDYFLVKPDCVRVPG
DPASAFSVFAVFDGHNGVSAAVYSKEHLLEHVMSALPPDIGRDDWLQALPRALVAGFVKA
DIDFQRKGEVSGTTATLVVIDGFTVTVASVGDSRCILDTQGGELQLLTVDHRLEENAEER
ERVTASGGEVGRLNLFGGQEVGPLRCWPGGLCLSRSIGDMDVGEYIVPIPHVKQVKLSNA
GGRLIIASDGIWDALSNEAAAKACRGLPAELAAKLVVKQALKTSGLKDDTTCVVVDIIPS
DHLTSPQLSPKKNHNKLKSLFRRRSHSSVGKLGGKSASIGSVEELFEEGSAMLEERLGRN
LSLKAVSAPFRCAICQVDQEPFEDLMRDNGGGYCSSPCAPWGGPYLCLDCRKKKDAMEGK
RSSCSTACR*

MATAARERRLPPALPLATLIGRELRAGGSERPALRYGHAGFAKRGEDYFLVKPDCLRVPG
DPASAFSVFAVFDGHNGVSAAVYSKEHLLEHVMSALSPDIGREDWLQALPRALVAGFVKA
DIDFQRKGEVSGTTATLVVIDGFTVTVASVGDSRCILDTQGGELQLLTVDHRLEENAEER
ERVTASGGEVGRLNLFGGQEVGPLRCWPGGLCLSRSIGDMDVGEFIVPIPHVKQVKLSNT
GGRLIIASDGIWDALSNEAAAKACRGLPAELAAKLVVKQALKTSGLKDDTTCVVVDIIPS
DHLTSPQLSPKKNQNKLKSLFRRRSHSSVRKLGGKSASIGSVEELFEEGSAMLEERLGRN
LSLKAASPPFRCAICQVDQEPFQDLMADNGGGYCSSQYAPWGGPCLCLDCRKKKDAMEGK
RCSRSTACR*

Other information
Ka divergence:-0.0601554KaKs divergence:-0.0716029
GC content 1 (%):57GC content 2 (%):58GC content divergence:0.009
Length 1 (bp):1290Length 2 (bp):1290Length divergence:0
MFE 1 (kcal):-545.36MFE 2 (kcal):-545.71MFE divergence0