Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G113062-GRMZM5G837364
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100274208
Function (paralog2):methionine aminopeptidase 1A

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.22826443378417
Log2 mRNA fold difference:-1.2572100697181
Log2 TE fold difference:1.0596760433433
Sequences
Protein sequence

MEKGASEASPPCARCGKPAQLQCPKCVELKLPRENAAFCTQDCFRAAWSSHKSVHPKPGA
PASQQSPEGWKYCLRKGRERALQLPRFDWTGPLRPHPISKMRVVPDEIEKPDWALDGIPK
IEPDSDLQKRVEIKTPDLIERMRVTCRIAREVLDAAARVIKPGITTDEIDRVVHEETIAR
GGYPSPLNYYFFPKSCCTSVNEVICHGIPDARKLEDGDIVNVDVTVYYKGVHGDLNETYF
VGNVDEASKHLVRCTYECLEKAIAIDSCAVKPGVRFREVGEVINRHVSMSGLSVVKSYCG
HGIGELFHCAPNIPHYSRNKAVGIMKAGQTFTIEPMVNAGVWNDRLWPDDWTAVTADGKR
SAQFEHTLLVTETGCEVLTARLPSSPDVFPWLKKP*

MEKGASEASAPCARCGKPAQLQCPKCAELKLPRENAAFCTQDCFRAAWSSHKSVHPKPGA
LASQQSPEGWKYCLRKGRGRALQLPRFEWTGPLRPYPISKMRVVPDEIEKPDWALDGIPK
IEPDSDLQKRVEIKTPELIERMRETCRIAREVLDAAARVIKPGITTDEIDRVVHEETIAR
GGYPSPLNYHFFPKSCCTSVNEVICHGIPDARKLEDGDIVNVDVTVYYKGVHGDLNETYF
VGNVDEASKQLVRCTYECLEKAIAIVKPGVRFREVGEIINRHASMSGLSVVKSYCGHGIG
ELFHCAPNIPHYSRNKAVGIMKAGQTFTIEPMINAGVWNDRLWPDDWTAVTTDGKRSAQF
EHTLLVTDTGCEVLTARLPSSPDVFPWLKP*

Other information
Ka divergence:-0.52888KaKs divergence:-0.692021
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):1188Length 2 (bp):1173Length divergence:-0.006
MFE 1 (kcal):-362.2MFE 2 (kcal):-356.61MFE divergence-0.008