Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G113098-GRMZM2G101058
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):GATA transcription factor 9 (LOC100281278), mRNA

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MASEWEMAMGVELGMGMGTYHYHHNASSITTAPMSSHHSGGASYSTPHHHHYYGMPPTGG
AGDAMRVDDLLDLSTGAGAGAHEFFPTAPAPATTDKGHHHPGAMGEPSPTAANSSDHQTS
LLSFADEFYIPSEEAAELEWLSKFVDDSYSDMPNYSSAAAHAAMAAAAAGNGGGGTSAGQ
DSCVTAAPAGRGARSKRSSRAPAAAAWHSLVSRPPSQPSPSSSSCSSSDFPSSSNRPARG
RKSPGPGGDAVAGSDGGVRRCTHCASEKTPQWRTGPLGPKTLCNACGVRFKSGRLVPEYR
PAASPTFVLTQHSNSHRKVMELRRQKELILIRGSHRDAAAAAGAGSAGPRPELMFRDYGV
C*

MASEWEMAMGVELGMGMGGTYHHNASSITTAPMMMSSHPHSHSGGAASYSTPHHHHYYGG
MPPMGDAMRVDDLLDLSTPGAGAHEFFPTAAPATDKGHHSSGAMGEPSPTANSSDHRTSA
LSFADEFYIPTEEAAELEWLSKFVDDSYSDMPNYSSATHAAMAAAAAAAANAAGNGGGTT
SAGQDSGVAAAPGRGARSRRSRATAAAAAVWHSLVPRPPSQSSPSSSSCSSSDFPSSNKP
ARPNGGSRGKKVPGPPGGGPAGGEAGLEGGGVRRCTHCASEKTPQWRTGPLGPKTLCNAC
GVRFKSGRLMPEYRPAASPTFVLTQHSNSHRKVMELRRQKELILIRGSHRDAAAGSAAGG
PRPELMFRDYGVC*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):71GC content 2 (%):71GC content divergence:0
Length 1 (bp):1086Length 2 (bp):1122Length divergence:0.016
MFE 1 (kcal):-559.3MFE 2 (kcal):-588.2MFE divergence0.025