Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G113139-GRMZM2G151387
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100381870

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:1.0181306111953
Log2 mRNA fold difference:0.90866588793547
Log2 TE fold difference:0.11848440354393
Sequences
Protein sequence

MSSYPVLNNRPIDQWRVTDLKDELRKRKLPVKGLKEELVKRLSDSIQSEREADEADEDVG
VNVDDQLPDANAIEENTVTVTEVHQETVVDVTHQVEVPTTEVGQESIISPTRGPPSVDVE
EASTTKGKVPESVARGNLTFEEVQVHTKSTNEPLHEKTTDVDTNDAVDVNSDLIPAEVKF
GATEASKIEEQDFPPAPVDDLTSDSTGPLGTDVVTAATSGAGPMDTDVFIATTSDAGPMD
TDVVTAAPVSDEGEKLAPKDASGNKVSMHDEEQNNSDTMNEDCKPIISQSNNQVPEVSQD
LGSQIKCESISTDNLSTNKKNNIEGNLNANNFDLELEIQPKMVEPSSGITPLGGDLQPLD
DDKELVKNQTSLEDIDSTDNVDSYKKDSPEGGSPEKLNLDRSSGDESMEEDTVEIKQDES
NMKSDDLGGKNEFNSEDVKEVILPDSVVEASKEAMAEEKSAASTEKRKLEAEEGVASTEP
IKRQRRWTADIAKVSGRQALSQTGPETPKESFQPAFKRSFGRSDSTASVDSPKERIVPPS
EKPPTTSLRIDRFVRPFTLKAVQEFLGKTGSVQDFWMDHIKTHCYVTFSSVDEAVATRDA
VYNLQWPPNNGNKLVAEFVDPQEVKLKVDPPPPPAAPVSPAAATRAPPVQHTQTNQSVPR
QAAAPKEELPPPPPPPLAKPPMADLTPLGRERLPPTPKKPEPPVVTLDDLFKKTQSSPRI
YYLPLSEEEVAAKLAAQGKGKKG*

MSSYPVLNNRPIDQWRVTDLKDELRKRKLPVKGLKEELVRRLFDSIQSEIEADEADEADE
DVGVNVDDQLPDANASEENTVTVTEVHQETVVHVTQQVEVPTTKAGQESTISPTRRAPSV
DVEEASADEEVPESVAEGNMSFEEVQVHTEITNEPVHEKTTDVDTNDTVVVNDAIDVNSD
LAPAEVKFGATEASKIEEHDFPPAPVDALNSDAAGPMDTDVVTAATSDVGSMDTDVVTRA
PVSDDEEKLELKVDLGNKVSMYDEDNNSSDTMNEDCKPIVSKPNNQVPEVSPDLGSQIKC
ESISTDNLSSNKKNTIKDNLNANNFDLELEVQPKMVQPSSGITSLGGDLQPLDDDKELVK
NQTSLEDIDSTANVDSYKKDSPEGGSPEKLNLDRSSGDESMEEDVVEIKQDEANMKSDDL
GQKNELNSEDVKEVILPDSVVEASKEVTAEEKSAASTEKRKLEDEDIANTEPIKRQRRWT
ADVAKVPERQALSQTGPETPKDIFQPAFKRSFGRSDSTASVDSPKERIVPPAEKPATTSL
RIDRFVRPFTLKAVQELLGKTGSVQDFWMDHIKTHCYVTFSSVDEAMATRDAVYNLQWPP
NNGNKLVAEFVDPQEVKLKVDPPPPPAAPVSPAAITRAPPLQQTQSVPRQAATPKEQLPP
PPPPPLAKPPMADPAAIARERLPPTPKKPEPPVVTLDDLFRKTQSSPRIYYLPLSEEEVA
AKLAAQGKGKKE*

Other information
Ka divergence:-0.179051KaKs divergence:-0.292931
GC content 1 (%):45GC content 2 (%):45GC content divergence:0
Length 1 (bp):2232Length 2 (bp):2199Length divergence:-0.007
MFE 1 (kcal):-700.1MFE 2 (kcal):-668.75MFE divergence-0.023