Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G113202-GRMZM2G139583
Species:maize
Duplication type:WGD
Function (paralog1):Myosin VIII ZMM3 Fragment
Function (paralog2):hypothetical protein LOC100277427

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.90099601839379
Log2 mRNA fold difference:-1.444224765804
Log2 TE fold difference:0.54155687054854
Sequences
Protein sequence

MASVEVRKSRALRARSGPSKLQPARSMPLDYRYSAGASPANGAGGGPDANGVGRRAAAAE
AENGGEVVVRLEGGDADSPYSSTAVTAAEEEEVGERGGGGDEVDSAATATPRRLSPRAAA
SPTEGDARWGDTSSYGAKKKHRVFCQLPNGDWALCTVITTSGDESVVKVSEGKVLRLKTE
CLQPANPEILDGVDDLMQLSYLSEPSVLYNLQYRYSKDMIYTKAGPVLVAVNPFKKVSLY
GNEYIDAYRNKSMDSPHVYAIADAALCEMKRDEVNQSIIISGESGAGKTETAKIAMQYLA
SLGGGSGIEYEILQTNPILEAFGNAKTLRNDNSSRFGKLIEIHFSTTGRICGAMIQTFLL
EKSRVVQCAVGERSYHIFYQLCAGAPASLKEKLNLKKVDGYKYLKQSCCYSIAGVDDAQM
FRTVTQAMNIVHISKEDQESVFAMVSAVLWLGDVSFTVIDNENHVEIIVDEASKTVSELL
GCSIEDLNLALSKRHMKVNNENIVQKLTLAQATDTRDALAKSVYASLFEWLVEQINKSLS
VGKRRTGRSISILDIYGFESFDKNSFEQFCINYANERLQQHFNRHLFKLEQEEYVEDGID
WAKVDFEDNQDCLSLFEKKPLGLLSLLDEESTFPNATDLTFANKLKQHLDSNSCFRGERG
KAFAVRHYAGEVAYDTSGFLEKNRDLLHMDSIQLLAKCKTSLPKMFASKMLVQSDNSMSV
PYRSSAADSQKLSVAMKFKGQLFQLMQRLESTTPHFIRCIKPNNLQLPAIYEQGLVLQQL
KCCGVLEVVRISRSGYPTRMTHQKFARRYGFLLEDVASQDPLSVSVAILHQFNILPEMYQ
VGYTKLFFRTGQIGNLEDTRNRTLHGILRVQSCFRGHQARHHARERTRGVLTLQSFIRGE
NARQIYSSLLRKHRAAVVLQRNVRCWLARRYFINVRKASVIIQSGIRGSLVRRCNGNIDL
INVLREFESKQEAHGDQILIKASVLAELQRRILKAEATVREKDEENEMLHQRLQQYENRW
LEYEQKMKAMEEMWQKQMRSLQSSLSVAKKSLVLDETPRMSDSSVDQSWESNGNHHVSSG
SQLVPHTGGREMNAGLSVISRLAEEFEQRSQVFADDAKFLVEVKSGQADASLNPDMELRR
LKQNFDSWKKDFSGRMRETKVILNKLGNGNESSPNSVKRKWWGRLNTSKFS*

MASVEVRSVRKSTALRARGGPSKLQSARSMPLDYRYSDGPSAANGAGGGPAGNGVGRRAV
AVEAGKEEKEGEVVRLEGDDADSPYSSNVVTAEEEAGNTGGGGDEVDSAAAATPRRLSPR
AAASPTQVDARWGDTSSYGAKKKHRVFCQLRNGDWALCTVLATSGDESVLKVSEGKVLRL
KTESLQPANPEILDGVDDLMQLSYLSEPSVLYNLQYRYSQDMIYTKAGPVLVAVNPFKKV
SLYGNEYIDAYRNKSMDSPHVYAIADAALCEMKRDEVNQSIIISGESGAGKTETAKIAMQ
YLASLGGGSGIEYEILQTNPILEAFGNAKTLRNDNSSRFGKLIEIHFSTTGRICGAMIQT
FLLEKSRVVQCAVGERSYHIFYQLCAGAPASLREKLNLKKVDEYKYLKQSCCYSIAGVDD
AQMFRTVTEAMDIVHISKEDQENVFAMVSAVLWLGDVSFTVIDNENHVEIIADEASKMVA
ELLGCSIEDLNLALTKRHMKVNNENIVQKLTLAQATDTRDALAKSLYASLFEWLVEQINK
SLSVGKRRTGRSISILDIYGFESFDKNSFEQFCINYANERLQQHFNRHLFKLEQEEYVED
GIDWAKVDFEDNQDCLSLFEKKPLGLLSLLDEESTFPNATDLTFANKLKQHLNSNSCFRG
ERDKGFAVRHYAGEVAYDTSGFLEKNRDLLHMDSIQLLAKCKTFLPKMFASKMLVQPDDS
MSVPYRSSAADSQKLSVAMKFKGQLFQLMQRLESTTPHFIRCIKPNNLQLPAIYEQGLVL
QQLKCCGVLEVVRISRSGYPTRMTHQKFARRYGFLLLEDVASQDPLSVSVAILHQFNILP
EMYQVGYTKLFFRTGQIGKLEDTRNRTLHGILRVQSCFRGHQARHHARERIRGVLALQTF
IRGEKARQIYSSLLRKHRAAVILQSNLRCWLARRYFINVRKASVIIQSGIRGSLVRRCNG
NIDLINVLREFESKQEAEGDQILIKASVLAELQRRILKAEATVREKEEENETLHQRLQQY
ENRWLEYEQKMKAMEEMWQKQMRSLQSSLSVAKKSLALHETPRMSDSSVDQSWESNGNHV
SSGSQLVPRTGGREMSAGLSVIGRLAEEFEQRSQVFADDAKFLVEVKSGQADASLNPDME
LRRLKHNFDSWKKDFSGRIRETKMILNKLGNGNESSPNSVKRKWWGRLNTSKFS*

Other information
Ka divergence:0.102071KaKs divergence:0.26879
GC content 1 (%):46GC content 2 (%):46GC content divergence:0
Length 1 (bp):3576Length 2 (bp):3585Length divergence:0.001
MFE 1 (kcal):-1223.26MFE 2 (kcal):-1179.68MFE divergence-0.018