Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G113203-GRMZM2G145446
Species:maize
Duplication type:TD
Function (paralog1):multidrug resistance associated protein 1
Function (paralog2):

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-2.2157668675357
Log2 mRNA fold difference:-4.206507091074
Log2 TE fold difference:1.9929007000261
Sequences
Protein sequence

MAGWSSSWICGEEDGGRLTLTVASKCVQRTLIDCVNVVLFIAYVCTLAAACVRRRQRSAD
ASSGRSGAPSRWVLLVVSTCCVAAAVAYCVTALQDAYDIKTAVPYFVRGLVWIALAASLH
AQPTRPARVVAVLWWVLLSLLATAYNSEILAGGHSLDLAEMIAWPVSLLLLLCALGSLLP
RGDGHHYRDASNGSSGLSEPLIGNDRTVPTSELYRAGLFGQLAFSWLNPLLRVGRSKALD
LGDIPLIATDDTAHHTSQQFTEAWSRHVSDKARSRRGVGSNSLALVLGKCFLSEILLTGF
YAFLRMLSIAVAPLLLFGFVWYSNQEERDLRVGLSLVGCLLLAKLVESLSQRHWFFSSRR
TGMRIRSALMAVIFQKQLRLSIQGRNNHSTGEIVNYIAVDAYRLGDAISWLHMGWTSPLQ
LVFAVATLFWALKLGALPGLVPLVIFGFLNVPFAKMLQGYQAKFMVAQDERLRSTSEILN
SMKIIKLQSWEDKFRSTIESLRDGEFKWLRQTQMKKAYGAVMYWMSPTVVSAVMYTATAI
MGSAPLNASTLFTVLATLRVMSEPVRMLPEVLTMMIQYKVALDRIEKFLLEDEIREDDVK
RVPSDDSGVRVRVQAGNFSWKASGADLSLRNVNLRVNRGEKVAVCGPVGSGKSSLLYALL
GEIPRLSGSVEVFGSVAYVSQSSWIQSGTVRDNILFGKPFNKELYDKAIKSCALDKDIEN
FDHGDLTEIGQRGLNMSGGQKQRIQLARAVYSDADVYLLDDPFSAVDAHTAAVLFYECVM
TALAEKTVVLVTHQVEFLTETDRILVMEGGQVSQQGKYSELLGSGTAFEKLVSAHQSSIT
ALDTSASQQNQVQGQQESDEYIVPSALQVIRQASDIDVTAKGPSAAIQLTEEEEKGIGDL
GWKPYKEYINVSKGAFQFSGMCIAQVLFTCFQIASTYWLAVAVQMGNVSAALLVGAYSGL
SIFSCFFAYFRSCFAAILGLKASKAFFGGLMDSVFKAPMSFFDSTPVGRILTRASSDLSI
LDFDIPYSMAFVATGGIEVVTTVLVMGTVTWQVLVVAIPVAVTMIYVQRHYVSSARELVR
LNGTTKAPVMNYASESILGVVTIRAFAATERFIYSNMQLIDTDATLFFHTIAAQEWVLIR
VEALQSLTIITAALFLVLVPPGAISPGFAGLCLSYALTLTSAQIFLTRFYSYLENYIISV
ERIKQYMHLPVEPPAIIPDSRPPTSWPQEGRIDLQDLKIRYRPNAPLVLKGITCTFAAGN
KIGVVGRTGSGKSTLISSLFRLVDPAGGRILIDKLDICSIGLKDLRTKLSIIPQEPTLFR
GTVRNNLDPLGQHSDEEIWEALEKCQLKTAISTTSALLDTVVSDDGDNWSAGQRQLFCLG
RVLLRRNKILVLDEATASIDSATDAILQKVIRQQFSSCTVITIAHRVPTVTDSDKVMVLS
YGKLLEYETPAKLLEDKQSAFAKLVAEYWANTKRNST*

MAFVATGGIEVVTTVLVMGTVTWQVLVVAIPVVVTMIYVQRHYVSSARELVRLNGTTKAP
VMNYASESILGVVTIRAFAATERFIYSNMQLIDTDATLFFHTVAAQEWVLIRVEALQSLT
IITAALFLVLVPPGAISPGFAGLCLSYALTLTSAQVFLTRFYSYLENYIISVERIKQYMH
LPVEPPAIIPDSRPPTSWPQERRIDLQDLKIRYRPNAPLVLQGITCTFAAGNKIGVAGRT
GSGKSTLISSLFRLVDPAGGRILIDKLDICSIGLKDLRTKLSIIPREPTLFRGTVHNNLD
PLGQC*

Other information
Ka divergence:0.536265KaKs divergence:-0.22955
GC content 1 (%):53GC content 2 (%):46GC content divergence:-0.071
Length 1 (bp):4434Length 2 (bp):918Length divergence:-0.657
MFE 1 (kcal):-1696.18MFE 2 (kcal):-287.54MFE divergence-0.71