Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G113401-GRMZM2G028855
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100276776
Function (paralog2):hypothetical protein LOC100277328

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MSKRTFSPFTARHRLQDSSRHRLQPPSSPSPQKRLELKRGSSASSPKALAALFRLLASRP
RATTCRQTLSPSLHPKTREAMVDAWWPLLGAAIPALVAGQFVRIKRRRDEEQRLKAARGR
EKSSDEVFVCERVCTSKRMLKKVGAFSKDPIPETCVTVCGVSELDACADACARTVCVNQH
QVPNWNDVCLKRCQSECLKLSSNLM*

MVDAWWSLLGAAFPALVAGQFIRTKRRRDEEQRLKAARGREKSSDEVFVCERVCTSKRML
NKVGAFSKDPIPETCVTVCGVSELDACADACARTVCVNQHQVPNWNDVCLKRCQSECLKL
SSTLM*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):63GC content 2 (%):65GC content divergence:0.016
Length 1 (bp):618Length 2 (bp):378Length divergence:-0.241
MFE 1 (kcal):-254.39MFE 2 (kcal):-180MFE divergence-0.171