Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G113629-GRMZM2G176443
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):protein disulfide isomerase

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.26995604582777
Log2 mRNA fold difference:-0.16892341479184
Log2 TE fold difference:-0.11524254903757
Sequences
Protein sequence

MVAYEFDKVPSTSCYPIQSIRNRVCSMAPFEENFLEDFVRQSLLPLVVPINTETLKMLND
DQRKVVLTILEDDSDENSTQLVKILRSAANANRDLVFGYVGIKQWDGFVETFDVSKSSQL
PKLLVWDRDEEYELVDGSERLEEGDQASQISQFLEGYRAGRTTKKKITGPSFMGFLNSLV
SLNSLYILIFVIALLFVMVYFAGQDDTPQPRRIHEE*

MAARVLPPPPLPLVLLLLLLPLSARDTVAAGEDFPRDGRVIDLDESNFEAALGVIDFLFV
DFYAPWCGHCKRLAPELDEAAPMLAGLSEPIVVAKVNADKYRKLGSKYGVDGFPTLMLFI
HGVPIEYTGSRKADQLVRNLKKFVAPDVSILESDSAIKNFVENAGTSFPMFLGFGVNDSL
IAEYGRKYKKRAWFAVAKDFSEDVMVAYEFDKVPALVAIHPKYKEQSLFYGPFEENFLED
FVRQSLLPLVVPINTETIKMLNDDQRKVVLTILEDDSDENSTQLVKILRSAASANRDLVF
GYVGIKQWDEFVETFDVSKSSQLPKLLVWDRNEEYELVDGSERLEEGTDQASQISQFLEG
YRAGRTTKKKISGPSFMGFLNSLVSLTSLYILIFVIALLFVMVYFAGQDDTPQPRRIHEE
*

www.000webhost.com

Other information
Ka divergence:-0.703532KaKs divergence:-0.847368
GC content 1 (%):42GC content 2 (%):46GC content divergence:0.045
Length 1 (bp):651Length 2 (bp):1263Length divergence:0.32
MFE 1 (kcal):-186.62MFE 2 (kcal):-418.48MFE divergence0.383