Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G113990-GRMZM2G131969
Species:maize
Duplication type:WGD
Function (paralog1):coiled-coil-helix-coiled-coil-helix domain-containing protein 4
Function (paralog2):hypothetical protein LOC100277506

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:4.9851967413852
Log2 mRNA fold difference:3.8960556513153
Log2 TE fold difference:0
Sequences
Protein sequence

MGCGASSHKDAGARRRRPGSVGDVVVFLPGLRVPRAVDFAQALGGCLARAIVERLSALRS
RVVEMAMQESAAALKPRRKAAARHGSSTANLLQALEDYLPVLLGLAQQGSVLRHKVQFTW
SNQEDNAEETAISDVWYEVLSVLHLMAMVCLLQANTLLLPRSYGDGYAPRVSEESRRATV
DVFLKAAGYLDCAIRHVLPKMPLELRRQLPVDLAEGNLKALSLQAFGSGG*

MGCGASSQKDAGAPRRRPVSVGDVVVFLPGLRVPRAVDLAQALGGCLARSAVDRLSALRS
RVVDMAMRESAAALKPRRRAAARHGSSTANLLQALEDYLPALLGLVKEGSVLRNKVHFTW
SNQEDNAEETAMPDAWYEVLSMLHLMAMVCLLQANALLLPRSYGDGYAPRVSEESRRATV
DVFLKAAGYLDCAVRHVLPKMPLELRRQLPVDLAEGNLKALSLQALGQGVDMQLGLAIDS
PKATLAVKRRLACEMVKYWQQVQESIPELPISDGWGKKHRLFIKWKYVEAKAAAYYFHGL
ILDEGNTEKSHGMAIAALQASEEFLKESKRVSEAFHATPPTSRSPNPFGTAKYLFDKIPR
DASSKVRINQDLYTQEKVIGAPPPLPDFALALTPEEYDLPPLDPLWNKEDTSH*

Other information
Ka divergence:-0.230663KaKs divergence:-0.689071
GC content 1 (%):59GC content 2 (%):54GC content divergence:-0.044
Length 1 (bp):693Length 2 (bp):1242Length divergence:0.284
MFE 1 (kcal):-291.57MFE 2 (kcal):-490.5MFE divergence0.254