Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G113995-GRMZM2G106795
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100381426
Function (paralog2):ADP-ribosylation factor

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MGQAFRKLFDSFFGTSEMRVVMLGLDAAGKTTILYKLHIGEVLSTVPTIGFNVEKVQYKN
VMFTVWDVGGQEKLRPLWRHYFNNTDGLIYVVDSLDRERIGKAKAEFQAIIKDPLMLNSV
ILVLANKQDMKGAMTPMEVCEGLGLYDLKNRIWHIQGSCALKGDGLYEGLDWLASTLKEL
QASGRLPSGGTSLF*

MGQAFRKLFDAFLGTSEMRVVMLGLDAAGKTTILYKLQIGEVLSTVPTIGFNVEKVQYKN
VMFTVWDVGGQEKLRPLWRHYFNNTDGLIYVVDSLDRERIGKAKAEFQAIINDPFMLNSV
ILVFANKQDMKGAMTPMEVCEGLGLYDLKNRTWHIQGSCALKGDGLYEGLDWMASTLKEL
QASGRLPSGGTSLF*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):47GC content 2 (%):47GC content divergence:0
Length 1 (bp):585Length 2 (bp):585Length divergence:0
MFE 1 (kcal):-195.9MFE 2 (kcal):-200.3MFE divergence0.011