Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G114036-GRMZM2G414047
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100384312

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:3.4987495312661
Log2 mRNA fold difference:4.563488502971
Log2 TE fold difference:-1.0163641634784
Sequences
Protein sequence

MEAYAAMASPPTKGMGVDKLSYEIFSLLERTFLLGPGTPPRALLDGGRVRVLAIDGCGAG
AEDALLAAAALARLEAGLRDRTGDPDARVADFFDLAAGAGAGGVLAAMLFLRGADGRPRY
TANEALAFVAGSIGGKGWGGRRRGPWAKLFRGAARGGDRSFFRSAFGDATLRDTVAPLLV
PCHDLATAAPFVFSRADAVESDSFDFRLRDVCAATCAAGGALASVRSVDGATAIAAASGG
VAAMGNPAAAAITHVLHNKQEFPLATGVQDLLVLSIGAGASATVCDGSSTPMPARSPSPR
ELARVTAEGVADMVDESVAMAFGDACGCKYVRIQARKAPAPLHAAAGAMLAQRSVESVLF
RGRRLSERTNAEKVDALAAELVKEQERRRHSPLPNVAIKQVATPRLSSATTTSSGTATAR
TASTMPSPASWDSRR*

MEAYAATASPPTTTAMCVDKLSHQLFSLLETRLLGGWCPSVPGTPARALLDGGRVRVLAI
DGCGAGAEDALLAAAALARLEARLRDRTGDPDARVADFFDVAAGAGAGGVLAAMLLLRGA
DGRPRYSAQEALAFVAGSVGTKGWCGRRGRWAKLFRRGSRGGDRTLRRVFGDATLRDTVA
PLLVPCYDLATAAPFVFSRADAVESDTFDFRLRDVCAAACAAGGAVAPVRSVDGLTAVAA
ASGGVAAMCNPAGTAITHALHNKQEFPLATGVDDLLVLSIGAGASAANGSSTPMPARSPS
PRELARVTAEGVADMVDESLGMAFGRARGSNYVRIQAGKALVPIRTDEASVAAEAMLAQR
NVESVLFRERRLSERTNAEKVDALAAELVKEQERRRRSPLPNVAIKQVGTPARLSSATTA
SSGTGTARTASTMPSPASWESRR*

Other information
Ka divergence:0.111216KaKs divergence:0.123198
GC content 1 (%):73GC content 2 (%):74GC content divergence:0.007
Length 1 (bp):1308Length 2 (bp):1332Length divergence:0.009
MFE 1 (kcal):-753.9MFE 2 (kcal):-749.66MFE divergence-0.003