Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G114044-GRMZM2G092981
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100272417
Function (paralog2):hypothetical protein LOC100276677

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MSQLLHLPDLAAPRTRMGSALAAGARVKQGEAGTARGRVLRVADPVRRECLVPVPPPPVL
AAGRRGDDDDVDEERQRYYLNLGYAIRTLREELPDVLCKDHSFDIYREDIVFRDPLNTFK
GLGNYKRLFWALRLTGRVFFRASWVEVVSIWQPAENSILLRWTAHGVPRVPWGWWDAAHA
RFDGASVYKLDRNGKIYEHKVHNVATNPPAKSKVLPVHELVRSLGCPSTAQPTCSDF*

MAQLLHLPDLAAARPPARRRRGVAVAVAGGRVKQGEAGRVIRVADPVREGRMPPPLLAAP
ATPSESPPVAGRRGDEDDEVRQRYYLNMGYAIRTLREELPDVLYKEPSFDIYRDDIVFTD
PLNTFKGLENYKTIFWALRFTGRIFFKALWVDIVSIWQPAENIIMIRWIAHGIPRVPWDG
HGRFDGASVYKLDKDGKIYEHKVHNVAMNPPTKFKVLPVHELIRSLGCPSTAKPTYFEAS
SQYLCAGPSYLRLAWIRCYISLCRMLSLANLGEG*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):67GC content 2 (%):56GC content divergence:-0.089
Length 1 (bp):714Length 2 (bp):825Length divergence:0.072
MFE 1 (kcal):-332.9MFE 2 (kcal):-333.2MFE divergence0