Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G114153-GRMZM2G046952
Species:maize
Duplication type:WGD
Function (paralog1):FIP1
Function (paralog2):FIP1

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MEKKAGREHVIGIPVNNRAFGIEEPDFSSKGAARNAAAAGRAAKSGWTTGDRVAQGLKEH
VALGPNLYETVRGKLSLGARILRAGGVEKAFRRWFSVVGKGERLLRASQCYLSTTAGPIA
GTLFVSTERIAFRSDRSLALTSPKRGTVVLVRVPYKVSIPLGRVKTATPGGNKDRPEQKY
VQVVTDDGFVFWFMGFVRYQVSLHELEKAIKQAQAQ*

MEKAGQHEHVIGIPVNNRAFGIEEPDFPSNGPAKNAAAGAGGRRRVTGDRVAQGLKEHVT
LGPKLYETVKGKLSLGARILRAGGVGKVFRRWFSSPVGGGGERLLRASQCYLSTTAGPIA
GMLFVSTERVAFRSDRSLALPLTSPAGGGSGSGTTTVLRVPYKVSIPLRRVAAARPGQNR
DRPEHKYVQVVTRDGFDFWFMGFVRYQASLQELEKAVAQSQSQ*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):66GC content 2 (%):70GC content divergence:0.029
Length 1 (bp):651Length 2 (bp):672Length divergence:0.016
MFE 1 (kcal):-311.36MFE 2 (kcal):-348.44MFE divergence0.056