Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G114399-GRMZM2G000256
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100192838

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAGALLSSPHYLWSPTSQPSLRPRSRGPLGTGAVRVLPPRRRARVLASCSREPAAMNRGL
EVERRRLLMSGLVSSFTIVLPISGAYAVMETNEDVKMNTQVDEINAYSFLYPVELPGKKF
SFKWVESRKPERYSSAAPLSPDARQRIVSERVDMIHNVVISVSIGPPNSRFLPSKDKSLW
DPKDVADCILSDRSTLKVTTGQRMTESSVLDAHATEVDGEPYWYYEYLVRKSPTKSASEP
NLFRHNVTCTAERDDGALSATDCCIISPSPTYRKLCSSLQGSLEILVNGDPFL*

MAGALLSSPHTLPSPTSQSPFRPRSRGPLHAGAARVLPPRRRAFVLASCSREPAARNRGL
EVERRRLLMSGLVSSFAIMLPISEAYAVMETDEDVKMNTQIDEINAYSFLYPVELPGKKF
TFKWVESRKPERYSSAAPLSPDARQRIVSERVDMIHNVVISVSIGPPNSRFLPSKDKSSW
DPKDVADCILSDRSTMKVTTGQRMTESSVLDAHVAEVDGEPYWYYEYLVRKSPTKSAPEP
NLFRHNVACTAERDGYLYSLNASTLSKQWESMGPFLQKTVASFRLLPGTENYVPPYKDPW
RFW*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):49GC content 2 (%):51GC content divergence:0.02
Length 1 (bp):882Length 2 (bp):912Length divergence:0.017
MFE 1 (kcal):-297.6MFE 2 (kcal):-316.48MFE divergence0.031