Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G114513-GRMZM2G170760
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100217151
Function (paralog2):hypothetical protein LOC100279280

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.72201467934053
Log2 mRNA fold difference:-1.2592745707767
Log2 TE fold difference:0.53541547875326
Sequences
Protein sequence

MASMQSWRKAYGAIKDTTTVSLANLNSDFKDLDVAIVKATNHVECPPKERHLRKVVAATS
IARPRADVAYCIHALARRLAKTRNWIVALKALVVIHRLLREGDPTFREELLNFTQRGRIL
QLSNFKDDSSPIAWDCSAWVRTYGLFLEERLECFRVLKYDVEAERLSKQGQGPEKGHSRT
RELDSQDLLEQLPALQQLLYRLVGCRPEGAANNNYLVQYALALVLKESFKIYCAINDGII
NLVDKFFEMPRHEAHKALEIYRRAGQQAGNLSDFYENCRGLELARNFQFPTLREPPQTFL
ATMEEYVKEAPRMVPVREPLELPERLLLTYKPEESEDIPEPASVEEENAPVEEPVLVPPV
TEVVSPPKTEVADTGDLLGLDDPNPAVSAIEESNALALAIVPTDGASTTGNTAFQDKGFD
PTGWELALVTAPSNTTSSASVGQLGGGFDKLILDSLYDDGAYRQRQQQQVYGSAVPNPFM
TNDPFVMSNQVAPPPSVQMAAMSQQHQQIPTMMQPNPFGPPMQPQVGMGPATNNPFLDAG
FGAFPVANNSHQQHNPFGSAQLL*

MASMQSWRKAYGAIKDTTTVSIANLNSDFKDLDVAIVKATNHVECPPKERHLRRVVAATS
ITRPRADVAYCIHALARRLAKTRNWIVALKALVVIHRLLREGDPTFREELLNFTQRGRIL
QLSNFKDDSSPIGLCAAWDCSAWVRTYGLYLEERLECFRVLKYDVEAERLSKQGQGPEKG
HSRTRELDSQDLLEQLPALQQLLYRLVGCRPEGAANNNYLVQYALALVLKESFKIYCAIN
DGIINLVDKFFEMPRHDALKALEIYRRAGQQAGNLSDFYENCRGLELARNFQFPTLREPP
QTFLATMEDYVKEAPRMVPVREPLELPERLLLTYKPEESEEILEPAPVEEEKVPVEEPVL
VPPVTEVVSPPPKAEVPDTGDLLGLDDTNPAVSAIEESNALALAIVPTDGASTTGNTAFQ
DKGFDPTGWELALVTAPSNTTSSTSVGQLGGGLDKLILESLYDDGAYRQRQQQQLYGSAA
PNPFMANDPFAMSNQVAPPPSVQMAAMSQQHQQIPTMMQPNPFGPPMHPQVSMAPATNNP
FLDAGFGAFPAANNGHQQHNPFGSAQLL*

Other information
Ka divergence:0.433799KaKs divergence:0.501869
GC content 1 (%):49GC content 2 (%):48GC content divergence:-0.01
Length 1 (bp):1692Length 2 (bp):1707Length divergence:0.004
MFE 1 (kcal):-567.94MFE 2 (kcal):-556.58MFE divergence-0.01