Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G114675-GRMZM2G174673
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100382415
Function (paralog2):hypothetical protein LOC100193099 (LOC100193099), mRNA

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.95757102117242
Log2 mRNA fold difference:-0.79603803908044
Log2 TE fold difference:-0.17770671198414
Sequences
Protein sequence

MSKEDVLKVQVGVRAICWPPSSQLSHPSFFPSRQAGRQLCLCLQQVFPLPRLLCSCPANV
CCCSLQIPPLLLFQTLMLRVNIHCDGCEKKVKKTLHKIDGVYQSSIDAEQGKVTVSGLLD
PDTIIRKLNKAGKPAQLWGSKPGVPQNGHGGGKGQPKDAGGGKGHSKDAGGGKAQKGGAG
GGGHKGAGGAGGGGGGAKDPKMVMPQPTPQQLQQLQQQLQMKGLKLPPHLLGGNMPAFPA
AAPLKDHPKSVKFALPEDSFDDDGGSEFDDDFDDDDFDDDEDYDDEGFDDDVYDEPKMMK
PMAVPPPSGGGDKKGGGGKKGGGGNEIPVQIKGNNHGGGQPHNAKGGPPGGGNPLAQGKK
GGGGGGAVGGPMGGMLPQQAMMRPNMLGGAGAGFPGTAQMGGGPMGMPMGHPHMGIMQQG
GGGGGGVPGLGFYQGNANGGGGGGMHSGAEMLQAAAASGNPMAQQQYMALLQHQQQQHQQ
QMMLQHGNGGGAGYPAMGYGYGRPPMMHYPMPPHSHPEPYNIFSDENPNSTCSLM*

MSKEDVLKVQTLMLRVNIHCDGCEKKVKKTLHKIDGVYQSSIDAEQGKVTVSGLLDPDTI
IRKLNKAGKPAQLWGSKPGIPQNAYHGGGKAHSKEAGGGKAHSKDSGGGKGHSKDAGGGK
AQKGGAGGGGHKGPGGGGGGGGGVGNPKMVMPQPTPQQLQQLQQQLQMKGLKLPPHLLGG
NMPAFPAAAPMKDPESVKFALPEDDFRRLRPRSSTMTSTTASTTTRTTTTTTAWTTTSTA
TPR*

Other information
Ka divergence:0.450914KaKs divergence:0.0154131
GC content 1 (%):65GC content 2 (%):63GC content divergence:-0.016
Length 1 (bp):1608Length 2 (bp):732Length divergence:-0.374
MFE 1 (kcal):-792.19MFE 2 (kcal):-337.9MFE divergence-0.402