Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G114772-GRMZM2G026889
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100280284
Function (paralog2):transferase, transferring glycosyl groups

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MAGLPPVARRRPLATASSLLLLLLLLVVTAAAREERGLARVQGPPPRHRHAYAAMMYMGT
PRDYEFYVAVRVMMRSLPRVRADADRVLIASADVPRDWVRAMTEEDGMRVLIVENLRNPY
ESNLGGTNKRFKLTLNKLYAWTLVDYERVVMIDSDNIFLQNTDELFQCGQFCAVFINPCY
FHTGLFVLQPSIDVFRSMLHDLETGRENSDGADQGFLVGCYPDLLDKPMFHPPENGTKLN
GTYRLPLGYQMDASYYYLKLHWHVPCGPNSVITFPSAPWFKPWYWWSWPVLPLGLSWHKQ
RWDDLGYAAEMPVILMELLMYIVIIAVTRLARPGITKLCYNRRPEKQSALVQWLIKLAAI
AAMVAAYSIPFFVVPRTVHPIMGWSVYLFGALALSVLVINVFLLPPLDVLTTWLAIVGML
IVMAFPWYHDGVVRALAVFGYAFCSAPILWASMVRMMDSLQTMLERDSFFPRIGEPAQET
EFSKLY*

MAGLPPVARRLRLRLATAALLLVLLLAVTAAVAAREGRGLARVQGPPPRHRHAYAAMMYM
GTPRDYEFYVAVRVMMRSLTRVRADADRVLIASADVPRDWVRAMTEEDGMRVVIVENLRN
PYEGNLGGTNKRFKLTLNKLYAWTLVDYERVVMIDSDNIFLQNTDELFQCGQFCAVFINP
CYFHTGLFVLQPSIDVFKGMLHDLETGRENSDGADQGFLVGCYPDLLDKPMFHPPENGTK
LNGTYRLPLGYQMDASYYYLKLHWHVPCGPNSVITFPSAPWFKPWYWWSWPVLPLGLSWH
KQRWDDLGYASEMPVILMEVLMYIVIITVTRLARPGMTKLCYNRRPEKQSALVQWLIKLT
AIVAMVAAYSIPFFVIPRTVHPIMGWSVYLFGALALSVLVINVFLLPPLDVLTTWLAIVG
MLFVMAFPWYHDGVVRALAVFGYAFCSAPFLWASVVRMMDSLQTMLERDPFFSRIGEPTQ
ETEFSKLY*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):55GC content 2 (%):57GC content divergence:0.018
Length 1 (bp):1461Length 2 (bp):1467Length divergence:0.002
MFE 1 (kcal):-561.01MFE 2 (kcal):-600.34MFE divergence0.034