Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G114793-GRMZM2G415007
Species:maize
Duplication type:WGD
Function (paralog1):Luminal-binding protein 2 Precursor (BiP2)(Heat shock protein 70 homolog 2)(B-70)(B70)
Function (paralog2):Luminal-binding protein 3 Precursor (BiP3)

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.42728608330074
Log2 mRNA fold difference:-0.35545240002544
Log2 TE fold difference:-0.092826733836653
Sequences
Protein sequence

MDRARGSAFLLGVLLAGSLFAFSVAKEETKKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN
DQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFADKEVQRDMKLVP
YKIINKDGKPYIQVKIKDGENKVFSPEEISAMILGKMKDTAEAYLGKKINDAVVTVPAYF
NDAQRQATKDAGVIAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSILT
IDNGVFEVLATNGDTHLGGEDFDQRIMEYFIKLIKKKYSKDISKDNRALGKLRREAERAK
RALSNQHQVRVEIESLFDGTDFSEPLTRARFEELNNDLFRKTMGPVKKAMEDAGLEKSQI
HEIVLVGGSTRIPKVQQLLRDYFDGKEPNKGVNPDEAVAFGAAVQGSILSGEGGDETKDI
LLLDVAPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFTTYQDQQTTVSIQVFEGERSMTK
DCRLLGKFDLNGIAPAPRGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNEKGRLS
QEEIDRMVREAEEFAEEDKKVKERIDARNQLETYVYNMKNTVGDKDKLADKLEAEEKEKV
EEALKEALEWLDDNQSAEKEDYEEKLKEVEAVCNPIVSAVYQRSGGAPGGDADGGVDDDH
DEL*

MDRVRGSAFLLGVLLAGSLFAFSVAKEETKKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN
DQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFQDKEVQRDMKLVP
YKIINKDGKPYIQVKIKDGENKVFSPEEISAMILGKMKDTAEAYLGKKINDAVVTVPAYF
NDAQRQATKDAGVIAGLNVARIINEPTAAAIAYGLDKKGGEKNILVFDLGGGTFDVSILT
IDNGVFEVLATNGDTHLGGEDFDQRIMEYFIKLIKKKYSKDIGKDNRALGKLRREAERAK
RALSNQHQVRVEIESLFDGTDFSEPLTRARFEELNNDLFRKTMGPVKKAMEDAGLEKSQI
HEIVLVGGSTRIPKVQQLLKDYFNGKEPNKGVNPDEAVAFGAAVQGSILSGEGGDETKDI
LLLDVAPLTLGIETVGGVMTKLIPRNTVIPTKKSQVFTTYQDQQTTVSIQVFEGERSMTK
DCRLLGKFDLNGIPSAPRGTPQIEVTFEVDANGILNVKAEDKGTGKSEKITITNEKGRLS
QEEIDRMVREAEEFAEEDKKVKERIDARNQLETYVYNMKNTVGDKDKLADKLEAEEKEKV
EEALKEALEWLDDNQSAEKEDYEEKLKEVEAVCNPIVSAVYQRSGGAPGGDADGGVDDDH
DEL*

www.000webhost.com

Other information
Ka divergence:0.573055KaKs divergence:0.957066
GC content 1 (%):56GC content 2 (%):56GC content divergence:0
Length 1 (bp):1992Length 2 (bp):1992Length divergence:0
MFE 1 (kcal):-805.5MFE 2 (kcal):-785.41MFE divergence-0.013