Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G114906-GRMZM2G108619
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100278787
Function (paralog2):hypothetical protein LOC100275618

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:0
Log2 mRNA fold difference:0
Log2 TE fold difference:0
Sequences
Protein sequence

MEDLKKFYPSFWKQSSSSRSSLHSIREHKLMDLGSRRNQTQEVSTNFNKRKPFSESVELT
SDVRTSVWRKSDAYHGVIDLEKPSISGDAIEAIGCSGFGNPANQNGKSQDGSCCISPENT
SLAESLQSCRDWNISRVSVGSVGSSDTPDCQSPIKTSNNEARHSLFDLNVPQEESLFMSS
TLVPSSSTYCGIFSDNRRETSEKEHIAGIRSMKGSSITVVTPNSVADSSRDVVTESPVQP
KFLFDLNVSLENTDMPSEICDYRDKDVNNDVSKGTAPRRSFSNKDSLHAETSTKHAVLGH
DHMLAHEDDSKVLLTSPTANGINKVQLTQSGTINKEFLIPGSPLVDTSFPPRLEISDNGA
SNIQELSMLQDKVDGDGTTADTAARTLLSIFQHSSERIAHCFGSSNQTAAQNVNDEPQPS
LDSFEQTVLNLEEIQDDGQSINVAPPYIEGPACRIKLKRGRGMRNFQREIIPGLLLGRQE
ICEDLEVIGYAPKKARSRKPRKGPGASSAQPRPCKRGAVKR*

MEDLNKFYASFWKQSSSSLSSLHSVHEHKLMNLGSKRNQTQEVSTNYNKRKSLSGIVELS
SDVRSSIRRKSDAYREVIDLEKPSVYGDAVEAIGCSGLGNLANQNGKSQDVSPQNNSLAE
SLQLCRDWKTSRVSVGSVGSSHTPDCQSPTKTSNNEARQSLFDLNVPPEESLLMPSTLFP
SSSTYCGNFSDRPRETSEKERVSGIGSTKGSSITVITPDSAADSSRDVVTESSVQQKFPF
DLNVSPENTNMPSEINDYRDKVVNNGVSKGTAPDHSFSTKNGLLAETSTKHVVLGHDSVL
AHKQDDSHVLLTVPTANGIDKAHSPQPGTINKEFLDPGSPLLDNNFHPRLGTSHNGASDI
QELSMLQCKVDDGGTTADTAARTLLSMFQHSSECVAHRPGSSNQTAAQKVDDEPQPSLDS
FEKTVLDSEEAKDDGQSVTVTPPFKEGPACRIKLKRGRGMRNFQREIVPGLLLGRQEICE
DLKAIGYEAKKARSRKPRKGPGASSARPRPRKRGAAKH*

Other information
Ka divergence:0KaKs divergence:0
GC content 1 (%):45GC content 2 (%):47GC content divergence:0.022
Length 1 (bp):1566Length 2 (bp):1557Length divergence:-0.003
MFE 1 (kcal):-487.7MFE 2 (kcal):-501.69MFE divergence0.014