Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G115000-GRMZM5G821267
Species:maize
Duplication type:WGD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100383455

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.8621385991209
Log2 mRNA fold difference:-1.8277325349786
Log2 TE fold difference:0.92081118549845
Sequences
Protein sequence

MEAMEAEEGPFLANDAKLHAGICRAFHPSVSKLSAIFPFIEASRPRSKPGIQALCSLHVA
LDKAKGLLQHCADCSRLYLAITSETVLLKFEKSRSQLQESLRRTESIVTEDIGCKIVEIV
GELEEIVFTLDRSEKEAGDELIKLLQRNNKTNGSSDSGELEVFHMSALKLGITSSRAALT
ERRALKKLIEKARSDEDKRKELVVSYLYNLMRKYSKFFRSETGDDTDSQGSSPCSPTVLG
MDDMYGPYNNGRAFSRQLSSIQSFNSRFGSFNSRLGSFNCRRGGGPRSENMSIPPEELRC
PISLQLMYDPVIISSGQTYERICIEKWFNDGHSTCPKTQQQLAHLSLTPNYCVKALIASW
CEQNDFPVPDGPPGTFDVNWRLALSDTEAAGCVSVESFDCANAKSVKVVPMENVRKEEPA
NSESGTLDDGSCNDFDLNEGYGNLLLLLHERSNMNKQCRLVEQIRYLLKDDEEARIQLGS
NGFAEALVEFLRNAVNDGNEKAQEVGAMALFNLAVNNNRNKGLLLSAGVTDLLEQMISNP
RLSGPATALYLNISCLPDAKAVIGSSQAVPFLVDRLYSQDGSDTRGSSCKHDALYTLYNL
SSHQASVPALLAAGIVDALHCLVTESPGSEEGLGWTEKALAVLISLAATQAGRKEIMSTP
GLVSTLAMLLDTGESTEQEQAVSCLLVMCGADDKCIAPVLQEGVVPSLVSISAAGTGRGR
EKAQKLLKLFREQRQRDTPPPQQQQQQLLQSQLAEGGNGGGGAIVCHRESKPLCKSKSRK
LGRTLSSLWKNRGFSLYQC*

MEAMEAEEGPFLANDAKLHAGICRAFHPSVSKLSTIFPFIEASRPRSKSGIQALCSLHVA
LDKAKGLLQHCADCSRLYLAITSETVLLKFEKSRSQLQESLRRIESIVTEDIGCKIVEIV
GELEQIVFTLDRSEKEAGDELINLLQRNNKTNGSSDNGELEVFHISALKLGITSSRAALT
ERRALKKLIEKARSDEDKRKELVVSYLYNLMRKYSKFFRSETGDDTDSQGSSPCSPTVLG
VDDMCSPYINGRAFGRQILSSQSFNSRFGSFNSRLGSFNCRRAAGGGPRSGNISVPPEEL
RCPISLQLMYDPVIISSGQTYERICIEKWFNDGHSTCPKTQQQLAHLSLTPNYCVKALIA
SWCESNDFPLPDGPPGTFDVNWRLASSDTEATGCVSVESFDCTSAKSVKIVLMEDARKEE
PANSVSGTLDDGSCNDFDLNEGYGSLLLLLHERSNMDKQCRLVEQIRYLLKDDEEARIQL
GSNGFAEALVEFLRNAVDDGNEKAQEVGAMALFNLAVNNNRNKGLLLSAGVAGLLEQMIS
NPRLSGPATALYLNLSCLPDAKAAIGSSQAVPFLVDCLYIQDASDTNGSSSKHDALYTLY
NLSSHQASVSALLAAGIVDALHRLLAESAAPPEEGLGWTEKALAVLISLAATEAGRKEIV
STPGLVSTLATVLDTGEPTEQEQAVSCLLVMCSADDECVAAVLREGVVPSLVSVSAAGTG
RGREKAQKLLKLFREQRQRDTAPAPQPQQQLLQSQLAEGGNGGGAIIACHHRESKPLFNV
KSRKLGRTLSSLWKNRGFSLYQC*

Other information
Ka divergence:0.474002KaKs divergence:0.441164
GC content 1 (%):51GC content 2 (%):52GC content divergence:0.01
Length 1 (bp):2400Length 2 (bp):2412Length divergence:0.002
MFE 1 (kcal):-897.35MFE 2 (kcal):-927.42MFE divergence0.016