Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G115065-GRMZM2G181259
Species:maize
Duplication type:TD
Function (paralog1):
Function (paralog2):hypothetical protein LOC100279291

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:2.511390662063
Log2 mRNA fold difference:3.6832155327181
Log2 TE fold difference:-1.1641713535402
Sequences
Protein sequence

MAPEARGEAAPVYRDALTPVEERVRDLLGRMTLREKAAQMAQIERTVATPRALTELGAGS
VLNAGGSMPCEQASPADWAAMVDGFQRLAISSRLGVPILYGTDAVHGHNNVYGATVFPHN
VGLGACRDGELARRIGEATALEVRATGIHWTFAPCVAVCRDPRWGRCYESYSEDPEIVRS
LTTIVSGLQGQPSADHPHGYPFLASPRENVLACAKHFAGDGGTDKGVTEGNAICSYEDLE
AIHMRPYPDCMAQGVATVMTSYSKWNGEPLHSSRYLLTDVLKGKLGFKGFLISDWEGIDR
ICEPRGSDYRYCIAQSVNAGMDMIMIPHRFEKFLDDIVFLVEAGEIPMSRIDDAVERILR
VKFISGVFEHPFSDQSLLDIVGCKEHRLLAREAVRKSLVLLKNGKDQKEPFLPLARDAKR
ILVAGTHADDIGYQCGGWTIAWPGDSGKVTLGTSILEAIQELVGVQTEVVHEKYPTKAMI
ETGGFSYAVVVVGEVPYAEWIGDRTDLSIPFNGSDLIIRVASKIPILVIVISGRPLIIES
QVLEKIDALVAAWLPGSEGMGITDCLFGDHDFVGTLPVTWYKSVDQLPINAGDSNYDPLF
PVGYGLKMFRSDDDST*

MAPEARGEAALVYRDALAPVEERVRDLLGRMTLREKAAQMAQIERTVATPRALTELGAGS
VLNAGGSTPCEQASPADWAAMVDGFQRLAISSRLGVPILYGTDAIHGHNNVYGATVFPHN
VGLGACRDGELARRIGEATALEVRATGIHWTFAPCVAVCRDPRWGRCYESYSEDPEIVRS
LTTIVSGLQGQPPADHPHGYPFLASPRENVLACAKHFVGDGGTDKGVNEGNAICSYEDLE
AIHMTPYPDCIAQGVATVMASYSKWNGEPLHSSRYLLTDVLKGKLGFKGFLISDWEGIDR
ICEPQKPRGSDYRYCIAQSVNAGMDMIMIPHRFEKFLDDIVFLVEAGEIPMSRIDDAVER
ILRVKFISGVFEHPFSDQSLLDIVGCKEHRLLAREAVRKSLVLLKNGKDQNKPFLPLAKD
AKRILVAGTHADDIGYQCGGWTIAWHGDSGKITLGTSILEAIQELVGVQTEVVYEKCPTE
AMIETGGFSYAVVVVGEVPYAEWTGDRTDLSIPFNGSDLIIRVASKIPTLVIVISGRPLI
IESQVLEKIEALVAAWLPGSEGMGITDCLFGDHDFVGTLPVTWCKSVDQLPIDAGDSNYD
PLFPVGYGLKMFRSDNDST*

Other information
Ka divergence:-0.291449KaKs divergence:0.996747
GC content 1 (%):52GC content 2 (%):52GC content divergence:0
Length 1 (bp):1851Length 2 (bp):1860Length divergence:0.002
MFE 1 (kcal):-684.54MFE 2 (kcal):-691.24MFE divergence0.005