Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G115420-GRMZM2G150024
Species:maize
Duplication type:WGD
Function (paralog1):somatic embryogenesis receptor-like kinase2
Function (paralog2):Putative uncharacterized protein

Regulation information
Data set:seedling-drought_Lei_2015
Log2 RF fold difference:-0.65872670219479
Log2 mRNA fold difference:0.63029763864871
Log2 TE fold difference:-1.2800217950069
Sequences
Protein sequence

MAASASAGRWWAVVLAVAVLLGPGRVVANTEGDALYSLRQSLKDANNVLQSWDPTLVNPC
TWFHVTCNNDNSVIRVDLGNAQLSGVLVPQLGQLKNLQYLELYSNNISGTIPPELGNLTN
LVSLDLYMNNFSGNIPDSLGNLVKLRFLRLNNNSLVGPIPVSLTNISTLQVLDLSNNNLS
GQVPSTGSFSLFTPISFANNPNLCGPGTSKPCPGAPPFSPPPPFNPPSPPTQSTGASSTG
AIAGGVAAGAALVFAVPAIAFAMWRRRKPEEHFFDVPAEEDPEVHLGQLKKFSLRELQVA
TDNFSNKNILGRGGFGKVYKGRLADGSLVAVKRLKEERTPGGELQFQTEVEMISMAVHKN
LLRLRGFCMTPTERLLVYPYMANGSVASRLRERQPSEPPLSWEPRRRIALGSARGLSYLH
DHCDPKIIHRDVKAANILLDEDFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLS
TGKSSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKVEMLVDPD
LQKAYEEVEVESLIQVALLCTQGSPLDRPKMSEVVRMLEGDGLAERWDEWQKVEVVRQEA
ESAPLRNDWIVDSTYNLRAVELSGPR*

MAAAGRWWAVVLAVAVLLWPGRVVANTEGDALYSLRQSLIDTNNVLQSWDSTLVNPCTWF
HVTCNSDNSVIRVDLGNAQLSGVLVPQLGQLKNLQYLELYSNKISGAIPPELGNLTNLVS
LDLYMNNFSGNIPDRLGNLLKLRFLRLNNNSLVGPIPVALTNISTLQVLDLSSNNLSGPV
SSNGSFSLFTPISFNNNPNLCGPVTTKPCPGDPPFSPPPPFNPPSPPTQSTGASGPGAIA
GGVAAGAALVFAVPAIAFAMWRRRKPEEHFFDVPAEEDPEVHLGQLKKFSLRELQVATDT
FSNKHILGRGGFGKVYKGRLADGSLVAVKRLKEERTPGGELQFQTEVEMISMAVHRNLLR
LRGFCMTPTERLLVYPYMANGSVASRLRERQASEPPLKWETRRRIALGSARGLSYLHDHC
DPKIIHRDVKAANILLDEEFEAVVGDFGLAKLMDYKDTHVTTAVRGTIGHIAPEYLSTGK
SSEKTDVFGYGIMLLELITGQRAFDLARLANDDDVMLLDWVKGLLKEKKVEMLVDPDLQN
AYEEIEVENLIQVALLCTQGSPLERPKMSEVVRMLEGDGLAERWDEWQKVEVVRQEAESA
PLRNDWIVDSTYNLRAVELSGPR*

Other information
Ka divergence:0.573394KaKs divergence:0.613477
GC content 1 (%):50GC content 2 (%):50GC content divergence:0
Length 1 (bp):1881Length 2 (bp):1872Length divergence:-0.002
MFE 1 (kcal):-685.2MFE 2 (kcal):-664.5MFE divergence-0.015