Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G115456-GRMZM2G384339
Species:maize
Duplication type:WGD
Function (paralog1):hypothetical protein LOC100273077
Function (paralog2):hypothetical protein LOC100274485

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-0.55569221080686
Log2 mRNA fold difference:-1.0500045385177
Log2 TE fold difference:0.56940405120201
Sequences
Protein sequence

MQGGVMAHAAAAAAAASTVTTAVAPPVTAHAVAVAPPVTAHAAAAAGNGSATAAPPPPFL
MKTYEVVDDPATDDVISWGPGNNSFIVWNTPEFARDLLPKYFKHSNFSSFVRQLNTYGFR
KVDPDRWEFANEGFLRGQKHLLKTINRRKPSLQGNSQPQQPQSQNAPVPSCVEVGKFGLE
EEIERLKRDKNVLMQELVRLRQQQQTTDHQLQTLGKRLQGMESRQQQMMSFLAKAMQSPG
FLAQFVQQNEKSRRRIVAANKKRRLPRQDGGLDSESAAASLDGQIIKYQPLINEAAKAML
RKILKLDSSHRLESMGNSENGNFLLENYMPGAQAFESSSSTRNSGVTLSEVSANPGLPYG
GGGGTSSGLSAICPPEIQCPVVMDNMSSNQVPSMSAVPPVSKATIDMGIPEFSALADLVN
EGSVDIPGGAFEMPGPEFPLPEGDDSVPIETDETMYNNNDETQSLPGIIDSFWEQFLVGS
PLSADNDEVDSGSPQENGWSKVGNIGDLTEQMGLLSSTNHRDSGNGL*

MQGGGVAAAAVPVHAAVGGDGGGAAAAPPPPFLMKTYEMVDDPATDGVVSWGPGNNSFIV
WNTPEFARDLLPKYFKHSNFSSFVRQLNTYGFRKVDPDRWEFANEGFLRGQKHLLKTINR
RKPSLQGNSQPQQPQLQNAPVPSCVEVGKFGLEEEIERLKRDKNVLMQELVRLRQQQQTT
DHQLQTLGKRLQGMESRQQQMMSFLAKAMQSPGFLAQFVQRNENSRRRIVAANKKRRLPK
QDGGLESESSAASLDGQIIKYQPSINEAAKAMLRKILNVDSSHRFESMGNSDNSNNNNIL
LEDYMPAAQAFESSSSTRNSGVTLAEVPANSGLAYVGTSSAICSPPAAPEMQCPVVLDNK
AYKQVASMSAVPPVSSDMGIIPEFSDLADLVSVDILGGAFEMMPGPEFPLPEEGDDGTTM
YNNNDEEAQSLPGIINSIWEQFLVGSPLSTDNEEVDSAGGLYAQEDGWSKVGNIANLTEQ
MGLVSSTNHRDSGNGLY*

Other information
Ka divergence:0.284114KaKs divergence:0.445451
GC content 1 (%):55GC content 2 (%):52GC content divergence:-0.028
Length 1 (bp):1584Length 2 (bp):1494Length divergence:-0.029
MFE 1 (kcal):-622.35MFE 2 (kcal):-548.89MFE divergence-0.063