Home
Search
Download
Help
Contact





Duplicate gene pair information
Duplicate gene pair:GRMZM2G115518-GRMZM2G173928
Species:maize
Duplication type:WGD
Function (paralog1):calcium dependent protein kinase1
Function (paralog2):CDPK-related protein kinase

Regulation information
Data set:seedling_Lei_2015
Log2 RF fold difference:-1.2073373029925
Log2 mRNA fold difference:-2.477587904805
Log2 TE fold difference:1.2753568298267
Sequences
Protein sequence

MGQCYGKARGASSRADHDADPSGAGSVAPPSPLPANGAPLPATPRRHKSGSTTPVHHHQA
ATPGAAAWPSPYPAGGASPLPAGVSPSPARSTPRRFFKRPFPPPSPAKHIKATLAKRLGG
GKPKEGTIPEEGGAGAGAGAGAGAAVGAADSAEADRPLDKTFGFAKNFGAKYDLGKEVGR
GHFGHTCSAVVKKGEHKGHTVAVKIISKAKMTTAISIEDVRREVKILKALSGHDNLVRFY
DACEDALNVYIVMELCEGGELLDRILARGGRYTEEDAKAIIVQILSVVAFCHLQGVVHRD
LKPENFLFTTRDESAPMKLIDFGLSDFIRPDERLNDIVGSAYYVAPEVLHRSYSMEADIW
SIGVITYILLCGSRPFWARTESGIFRSVLRADPNFDDSPWPSVSAEAKDFVKRFLNKDYR
KRMTAVQALTHPWLRDEQRQIPLDILIFRLVKQYLRATPLKRLALKALSKALSEDELLYL
RLQFKLLEPRDGFVSLDNFRAALTRYSTDAMRESRVLEFQHALEPLAYRKMDFEEFCAAA
ISPYQLEALERWEEIAGTAFQHFEQEGNRVISVEELAQELNLAPTHYSIVQDWIRKSDGK
LNFLGFTKFLHGVTIRGSNTRRH*

MGQCYGKAGGASSRRADHDDHAHAVAPPSPLPANGAPPPQPATPGRRKSGSATPVHHQAA
TTAWPSPYPAGGASPLPAGVSPSPARSTPRRFFKRPFPPPSPAKHIKATLAKRLGGGKPK
EGTIPEEGGAGVAADSAEAERPLDKTFGFANNFGAKYDLGKEVGRGHFGHTCSALVKKGE
YKGHAVAVKIISKAKMTTAISIEDVRREVKILKALSGHNNLVKFYDACEDALNVYIVMEL
CEGGELLDRILARGGRYTEEDAKAIVVQILSVVSFCHLQGVVHRDLKPENFLFATRDESA
PMKLIDFGLSDFIRPDERLNDIVGSAYYVAPEVLHRSYSMEADIWSIGVITYILLCGSRP
FWARTESGIFRSVLRADPNFDDSPWPSVSAEAKDFVKRFLNKDYRKRMTAVQALTHPWLR
DEQRQIPLDILVFRLVKQYLRATPLKRLALKALSKALREDELLYLRLQFKLLEPRDGLVS
LDNFRTALTRYVTDAMRESRVLEFLHALDPLAYRKMDLEEFCAAAISPYQLEALESWEEI
AGTAFQHFEQEGNRVISVEELAQELSLAPTHYSIVQDWIRKSDGKLNFLGFTKFLHGVTI
RGSNTRRH*

Other information
Ka divergence:0.148754KaKs divergence:0.258906
GC content 1 (%):54GC content 2 (%):54GC content divergence:0
Length 1 (bp):1872Length 2 (bp):1827Length divergence:-0.012
MFE 1 (kcal):-757.7MFE 2 (kcal):-717.53MFE divergence-0.027